(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE460

MICSR_1.PE460        Location/Qualifiers
FT   CDS_pept        complement(913082..913807)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637378"
FT                   /orf_name="MICPUN_107931"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62248.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI000199AC41"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y7"
FT                   /transl_table=1
FT                   /translation="MWGALCPIVFGERRWAQLSDAKQYEIRLAFNCAVNGILAPALVYP
FT                   ALTSTPPLNQNGLYATVFPRHEGSVLGCAASVGYLLYDLLAMLSNFTVSIKANGVVAYN
FT                   LYIWHHALSIMFWPVAVLHNSFVFFVNWFVASEASSTFLAARGAMLSLGTINTPVGVAV
FT                   QLGFVASFFMSRIYVMPNLIKSIYYADWGQVPAWQANIARCTVPLPFLLNIYWWMMILR
FT                   SMYKVIFGKKRGGKGKKAA"
     atgtggggcg cgctttgccc gatcgtgttc ggcgagcgtc gatgggcgca gctctcagac        60
     gcgaagcagt acgagatcag gctcgcgttc aactgcgcgg tgaacggcat tctggcgccg       120
     gcgctggtgt accccgcgct cacgtccacc ccgccgttga atcaaaacgg gctctacgcg       180
     accgtcttcc ctcggcacga gggatcggtc ctcgggtgcg cggcgtcagt cgggtacctc       240
     ctctacgacc tcctcgccat gctctccaac ttcaccgtca gcatcaaggc caacggcgtg       300
     gtggcgtaca acctctacat ctggcaccac gcgttgtcca tcatgttctg gcccgtcgcg       360
     gtgcttcata attccttcgt gttcttcgtc aactggttcg tggcgtcgga ggcgagcagc       420
     accttcctcg cggcgcgcgg cgccatgctc tcgctcggga cgatcaacac ccccgtcggc       480
     gtggcggtgc aactcgggtt cgtcgcctcg ttcttcatga gccggatcta cgtcatgccc       540
     aatctgatca agagcattta ctacgcggac tgggggcagg tgcccgcgtg gcaggcgaac       600
     atcgcccggt gcacggtgcc gctgccgttt ctgctgaaca tctactggtg gatgatgatc       660
     ctcaggtcca tgtacaaggt tatcttcggc aagaagaggg gcggcaaggg gaagaaggcg       720
     gcgtga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page