(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE461

MICSR_1.PE461        Location/Qualifiers
FT   CDS_pept        join(<914135..914704,914816..>914920)
FT                   /codon_start=1
FT                   /gene_family="HOG000021237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637379"
FT                   /orf_name="MICPUN_70512"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61825.1"
FT                   /db_xref="HOGENOM:HBG381802"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniParc:UPI000199AC42"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y8"
FT                   /transl_table=1
FT                   /translation="CTVDRVHWTEMTADRFDGQYRDHKPVVLTGMRGRNDAFRNACAKD
FT                   VLLREWGDKDIVLSTANTHSYLKVTKTLREYVSSHTAPQRLDRRGDETLIWFGDNNHTE
FT                   WRSHFDLYVPPPFGTSDADVAYSFGVGGPHSGVPLHVHGPGWSETIVGRKRWWLSPPKP
FT                   KPRFHPNATSLEWALGLKPLQEGDEGRMLECTIGEGEAVWFPDGWWHATLNLDESAFIS
FT                   SFV"
     tgcaccgtcg atcgggtcca ctggacggag atgaccgccg acaggtttga cggacagtac        60
     cgggaccaca aaccggtggt gctgacgggc atgcgcggcc gcaacgacgc gttccgcaac       120
     gcgtgcgcca aggacgtctt gctccgcgag tggggcgaca aggacatcgt gctctccacc       180
     gccaacaccc attcgtacct caaggtgacg aagaccttgc gtgagtacgt gtcctcgcac       240
     acggcgccgc agcggctgga tcgacgcggc gacgagacct tgatatggtt cggggacaac       300
     aaccacacgg agtggcggtc gcacttcgac ctgtacgtcc cgccgccgtt cgggacgtcc       360
     gacgccgacg ttgcgtacag cttcggggtg ggcggaccgc actcgggggt gccgcttcac       420
     gtgcacggac cgggttggag cgagacgatc gtcggtcgca agcgatggtg gctctccccg       480
     cccaagccca aaccgaggtt ccaccccaac gccacgtccc tggagtgggc gctggggctc       540
     aagccgctgc aggaggggga cgaagggagg atgttggagt gtaccatcgg ggagggtgag       600
     gcggtgtggt tccccgacgg gtggtggcac gcgacgctca acctggacga gagcgctttc       660
     atcagttcat ttgtc                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page