(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE462

MICSR_1.PE462        Location/Qualifiers
FT   CDS_pept        join(complement(919382..919867),complement(918633..919309),
FT                   complement(915832..916045))
FT                   /codon_start=1
FT                   /gene_family="HOG000199411" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637380"
FT                   /orf_name="MICPUN_80084"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62249.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015748"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AC43"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y9"
FT                   /transl_table=1
FT                   /translation="MGACVSIDRSNSIDGARDPRVPRFERPRRAGFSGRTAADLHLDRI
FT                   DIDDVRCVEGGNGPDGHTTGDLGGDRRAEAKGTRSPRKAVDEDEIVQSPSREESPRAVA
FT                   EFVGDDDSTEDSEERTIRWQRGELVGSGGFGRVYVGLDLDTGGMLAVKQIAIAPRISRS
FT                   VRRIEQEVALMRRLKHPNIVSYLGTERTREDVFTIFMEYVSGGSIHSLLQRFGSFGESV
FT                   IRVYTRQILLGLEYLHRHQIMHRDIKGANILVDNQGCVKLADFGASKRLAEIVTVDGVH
FT                   KSIRGTPYWMAPEVIKQTGHGRQADIWSVGCTILEMATGKPPFSEFGSQVSALFHIASS
FT                   TGPPPIPEFLSAEAHDFLILCFNRVPRDRPNATRLLRHPFAVPAPSSGSPTPPRCCKRA
FT                   SWSSSTPSARSSTWRCTFTEDLQTRTSVMRSCSCGSFQRRSPSPTWRTQSGRRRQNARS
FT                   "
     atgggcgcgt gcgtgtctat cgaccgttcg aactcgatcg acggtgcgag ggatccgcgc        60
     gtaccccgat tcgagcgacc gcgacgggcg ggattctccg ggaggaccgc ggcggacctt       120
     cacctggacc gcatcgacat cgacgacgtc cgatgcgttg aaggtgggaa cggccccgac       180
     ggccacacga cgggcgatct cggaggcgat aggcgggcgg aagccaaagg cacgcggagt       240
     ccgaggaagg ccgtcgacga ggatgaaatc gtgcagagcc catcgcgcga ggagtccccg       300
     cgagcggtcg ccgaattcgt cggggacgac gactcgaccg aggattccga ggagcggacc       360
     atccggtggc agagaggcga gctcgtgggt agcggcggct tcgggcgcgt gtacgtcggc       420
     ctcgacctcg acaccggggg gatgctggcg gtgaaacaaa tagcaatcgc tcccaggata       480
     tccaggagcg tgcgacgcat cgagcaggag gtggcgctca tgcgacggct caagcacccg       540
     aacatcgtgt cgtacttggg caccgagcgc accagggagg acgtgttcac cattttcatg       600
     gagtacgtca gcggcggctc gatccactcg ctgctgcagc gattcgggag ctttggcgag       660
     agcgtcatac gcgtgtacac gcggcagata ttgctggggc tggagtacct gcacagacac       720
     cagatcatgc acagggacat aaagggcgcg aacatcctgg tggataacca gggctgcgtg       780
     aagctcgcgg actttggcgc gagcaagagg ctagcggaga ttgtgaccgt cgacggggtg       840
     cacaagagca tcaggggcac gccgtactgg atggcgcccg aggttatcaa gcagacggga       900
     cacgggcgcc aggcggatat ttggtccgtg gggtgcacga tactggagat ggcgacggga       960
     aagccaccgt tcagcgagtt tggcagtcag gtttcggcgc tgttccacat tgcgtcgagc      1020
     acaggaccgc cgccgatacc agagtttctc tcggcggagg cgcacgattt cctcattctg      1080
     tgcttcaaca gggtgccccg cgacagaccg aacgcgactc ggctccttcg gcatccgttc      1140
     gctgtccccg cgccttctag cggttcaccg acaccaccga ggtgctgcaa gagggcgtca      1200
     tggagttcgt caacaccatc ggcaagatcg tccacatgga ggtgcacctt cacggaggat      1260
     ctgcaaacaa gaacatcggt gatgcgttcc tgctcgtgtg gaagtttcca aaggagatct      1320
     ccctcgccga cgtggagaac ccagagcgga cgacgccggc aaaacgcgcg gtcatag         1377
//

If you have problems or comments...

PBIL Back to PBIL home page