(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE463

MICSR_1.PE463        Location/Qualifiers
FT   CDS_pept        join(920480..920590,920669..>921646)
FT                   /codon_start=1
FT                   /gene_family="HOG000200795" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637381"
FT                   /orf_name="MICPUN_68182"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61826.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG316723"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199AC44"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z0"
FT                   /transl_table=1
FT                   /translation="MGPRTPVRVEDLVALANTSTWAEPDAVNYRVVKDADDYQSPIINV
FT                   AHLTGLEGNAHYHYAIPGDTKTHRHFNAPPDSLKESSEDAAAGKEVHASTVFAVVGDTG
FT                   QTEVTAAVFEHIAGMDDADVLLHTGDLSYADGFPPRWDTFGRLAEGVMDRLPSLFVAGN
FT                   HDVTSNGVESQAYHTRYPSPHRSSGSASPEWWSLDVGLAHVIGFSSYAPSKGPGAFDGA
FT                   DAPLTRWLEKDLKKVNRAITPWIIVVFHVPWYNSNHGHFKEAERARVALEKLLYEAGVD
FT                   VVLNGHVHSYERIRAVYDYQPNECGVSHIVVGDGGNYEGPYGESWMNPQPAWSAFREGS
FT                   FGAGRLELHNATHATWEWRRTTC"
     atgggcccgc ggacccccgt gcgcgtcgag gacctcgtcg ccctcgcgaa cacgtcaacg        60
     tgggcagaac cggacgcggt caactaccgc gtggtcaaag acgcggacga ctaccagtcg       120
     ccgattatca acgtcgcgca tctcaccggg ctcgagggca acgcgcacta ccactacgcc       180
     ataccgggcg ataccaagac gcacaggcac ttcaacgcgc cgcccgattc gctcaaggag       240
     tccagcgagg acgccgccgc cgggaaggag gtgcacgcgt caaccgtgtt tgccgtcgtc       300
     ggggacaccg gccagacgga ggtcaccgcg gcggtgttcg aacacatcgc ggggatggac       360
     gacgccgacg tgctgctgca taccggcgac ctgtcctacg cggacgggtt tccgccgagg       420
     tgggacacct tcgggcgcct ggcggagggg gtcatggacc gtctgccctc cctctttgtc       480
     gcgggcaacc acgacgtgac ctcgaacggc gtcgagtcgc aggcgtacca cacgcggtac       540
     ccatcgccgc acaggtccag cgggagcgcg tcgcccgagt ggtggagtct cgatgtcggt       600
     ctggctcacg tcatcgggtt cagcagctac gcgccgtcga agggtcccgg cgcgttcgac       660
     ggggcggatg cgccgctgac caggtggctc gagaaggatc tgaaaaaggt gaatcgagcg       720
     attaccccgt ggatcatcgt cgtgttccac gtgccgtggt acaactccaa ccacgggcac       780
     tttaaggagg cggagcgcgc gagggtcgcg ctggagaagc tcctgtacga ggcgggtgtc       840
     gacgtcgtcc tcaacgggca cgtgcactcc tacgaacgca tccgcgccgt ttacgattac       900
     caaccaaacg agtgcggcgt ttcccacatc gtcgtcggcg acgggggaaa ctacgaaggt       960
     ccgtacgggg aatcgtggat gaatccccag cccgcgtgga gcgccttccg cgagggatcg      1020
     ttcggcgcgg ggaggctcga gcttcacaac gcgacgcacg cgacgtggga gtggcggagg      1080
     accacctgc                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page