(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE465

MICSR_1.PE465        Location/Qualifiers
FT   CDS_pept        923611..924441
FT                   /codon_start=1
FT                   /gene_family="HOG000100028" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637383"
FT                   /orf_name="MICPUN_57049"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61827.1"
FT                   /db_xref="HOGENOM:HBG560231"
FT                   /db_xref="UniParc:UPI000199AC46"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z2"
FT                   /transl_table=1
FT                   /translation="MDSSTSLTRTETPKSKPDVKKEVIPPKVQHSFEDIEGLINNLLML
FT                   NTFTLGFSISFLAAFENEALLAMDQRYFNVFTGAFKGSADDSGKLMIKSFGEQHIGEDY
FT                   SLSPSGTILVRGMRSTTCLTFSLIVGLASYVSMCLSDAREDQKFFIKWYSWFKWIILSG
FT                   YCLYVAGFTLFYLMVAASAYALFPMYCGAKRGFLSNSVWLDTKVDFDASGAPQEGCFIK
FT                   GMKDPVGDTTLILNIMMPAILLFCGIVTYAMHYKTKVIKSGRVGADGTLYGRWK"
     atggactcgt ccacgagcct cacccggacc gagacaccca agagcaagcc ggatgtgaag        60
     aaggaggtga ttcctcccaa ggtgcagcac agcttcgagg acattgaggg actcatcaat       120
     aaccttctca tgctcaacac attcactctc ggtttcagca tcagcttcct cgcggcgttc       180
     gagaacgaag cgcttctggc gatggaccag cgctacttca atgtcttcac tggtgctttc       240
     aagggtagtg cagatgattc gggtaaattg atgatcaaat cgttcggcga gcaacacata       300
     ggagaagatt actcgctctc tccgtctggc accatactcg tccgcggtat gcggtccacc       360
     acctgcctga cgttttccct catcgtcggc ctcgcgtctt acgtctcgat gtgtctcagc       420
     gacgcgaggg aggatcagaa gttcttcatc aagtggtact cctggttcaa atggatcatc       480
     ctgagtgggt actgcctcta cgtcgcggga ttcacgctgt tctatttgat ggtggcagcc       540
     tccgcctacg cgcttttccc catgtactgc ggggccaagc ggggattcct gagcaactcg       600
     gtgtggctcg acacgaaggt tgactttgac gcaagcggcg ctccccagga gggctgtttc       660
     atcaagggca tgaaggatcc cgtcggggac accaccctca tcctgaacat catgatgccc       720
     gcgatcctac tcttctgcgg catcgtgacc tacgcgatgc actacaagac caaggtgatc       780
     aagtccggga gggtcggcgc ggacgggacg ctctacggca ggtggaagtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page