(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE466

MICSR_1.PE466        Location/Qualifiers
FT   CDS_pept        join(complement(926060..926215),complement(924556..925914))
FT                   /codon_start=1
FT                   /gene_family="HOG000012406" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637384"
FT                   /orf_name="MICPUN_105296"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="binding"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase, V1 domain"
FT                   /protein_id="ACO62251.1"
FT                   /db_xref="GO:0000221"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG317811"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199AC47"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z3"
FT                   /transl_table=1
FT                   /translation="MIHPTDDLREVLERGARWNALLTSRLVTDEDLQAIQRYELRDEDA
FT                   RADMMDEEGDACARAFLNVLGDVSQTEYVQYVLALVARMLSDDKTRAAHFLAVEKKDDD
FT                   DKGQGGGGGGGGGEAYAVFLRLLAAPDWFTREKAMFCLTRLIDQRPARDKGLRFSEDGE
FT                   PATPAGVAAVRLSRWLCQELSADPPFHPQRAVPSCVTALASLLSIREVRPVATRAGAAR
FT                   AIAPLLKVAAGPHNVQELYEAGLCAWLLTFHPPACDAMARCGVIRGLMEVAGAAAKEKV
FT                   VRVATLALRNLASATGARETRGEEEAEAGSDGTRTAGDGGGGGVVGVSGVVGVSLVAQE
FT                   SALRKLVQNLRLRDFHDEELLAALADLEDGVLARRKEASSWDRYRAEVTSGALDWTAAH
FT                   IDEGFWRENASKLTDNNCQLLRMLVAAASDPGAEPRTLAVVCHDLGEFATHYPAGRFLV
FT                   QDLKGKDCAMRLLAHADDEVRKQALLCTQKLLVQKWQFLGGEVSSA"
     atgatacacc ccacggacga cctgcgcgag gtgctggagc ggggcgcgcg ctggaacgcg        60
     ctgctgacct cgcgcctcgt caccgacgag gacctgcagg ccatccagcg ctacgagctt       120
     cgcgacgagg acgcgcgcgc tgacatgatg gacgaggagg gagacgcgtg cgctcgagcg       180
     ttcctcaacg tcctcggcga cgtgtcgcag accgagtacg tccagtacgt cctcgcgctc       240
     gtcgcgcgga tgctatcgga tgacaagacc cgcgcggcgc acttcctcgc cgtcgagaag       300
     aaggacgacg acgacaaggg gcagggcggc ggcggcggcg gcggcggcgg cgaagcttac       360
     gccgtgttcc ttcggctgct cgccgcgccc gactggttca cccgcgagaa ggcgatgttc       420
     tgcctgacgc ggctcatcga tcagcgaccg gcgcgggaca aggggcttcg gttctccgag       480
     gacggcgagc ccgcgactcc cgcgggcgtc gcggctgttc gactgtcgcg ttggctgtgc       540
     caggagctct cggcggaccc gccgttccac ccgcagcgcg cggtcccgtc gtgcgtcacc       600
     gcgctcgcgt cgctcctctc catccgcgag gtccgccccg tcgcgacgcg cgcgggggcg       660
     gcgcgggcca tcgccccgct cctcaaggtt gccgccgggc cgcacaacgt gcaggagctg       720
     tacgaggcgg gtctgtgcgc gtggctgctc acgttccacc cgcccgcgtg cgacgcgatg       780
     gcgcggtgcg gggtgatccg gggcttgatg gaggtggcgg gcgcggcggc gaaggagaag       840
     gttgtcaggg tcgcgacgct cgcgctgaga aacctggcgt cggcgacggg ggctcgggag       900
     acccggggcg aggaggaggc ggaggcgggt tcagacggga cgcggaccgc gggcgacggc       960
     ggcggtggcg gcgtcgtcgg cgtgagcggc gtcgtcggcg tgagcctcgt ggcgcaggag      1020
     tcggcgcttc gaaagctggt tcagaacttg aggcttcggg actttcacga cgaggagctc      1080
     ctcgccgcgc tcgccgacct cgaggacgga gtgttggcca ggcgcaagga ggcgagctcg      1140
     tgggatcggt acagggcgga ggtcacgtcc ggtgcgctgg actggaccgc cgcgcacatc      1200
     gacgagggct tttggcgcga gaacgcgtcc aagctgacgg ataacaactg ccagctcctc      1260
     aggatgctcg tcgccgccgc gagcgacccg ggcgccgagc cccggacgct cgcggtggtt      1320
     tgtcacgatc tcggcgagtt cgccacgcac tatcccgcgg gcaggttcct ggtgcaggac      1380
     ctcaagggta aggattgcgc gatgcggctg ttggcgcacg cggacgacga ggttcgcaag      1440
     caggcgctgc tttgcacgca gaagctgctc gtgcaaaagt ggcagtttct gggcggcgag      1500
     gtttcgagcg cgtga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page