(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE467

MICSR_1.PE467        Location/Qualifiers
FT   CDS_pept        929164..930042
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637385"
FT                   /orf_name="MICPUN_52266"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61828.1"
FT                   /db_xref="UniParc:UPI000199AC48"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z4"
FT                   /transl_table=1
FT                   /translation="MWGITQALDLIDSAWGFASLDEDDEFLPSLDEDDIPVPSANFGFG
FT                   GGFYNNAFKRDFGVPIGKPQYDWTAPKAAPSLRSSEAADALELWAGAAGRLFAGEAEPL
FT                   IFRGGVDPSTLLREIPDVGMTIDEDEDEDEDIDLEDTARRDAVDAGFSLGWFSSPLGGN
FT                   DTGAYRFVVRDDEPAGPAAAAVGRDGIAVVIDEELRPVGVLRGSPDAMFFDVDAKVREV
FT                   MGMSPAVIEGDTATVGDVAVVCAAAAHDEPVAITDSEGRLRRVLRQEDLLEPIRSQLRE
FT                   QSESRFGNATR"
     atgtggggta tcacgcaggc gctcgacctc atcgacagcg cgtggggatt cgcatcactc        60
     gacgaggacg acgagttcct cccctcgctc gacgaggacg acatcccggt tccatccgca       120
     aactttggct ttggcggcgg cttttacaac aacgcgttca agcgcgattt cggcgtgccc       180
     atcggcaagc ctcagtacga ctggaccgca ccgaaggcgg cgccgtcgct gaggtcctcc       240
     gaagctgcgg acgcgctcga gctgtgggcg ggagccgcgg gccggctctt tgcgggtgaa       300
     gccgagccgc tgatattccg cggcggcgtg gacccgtcca ctctgctccg cgagatcccg       360
     gatgtcggca tgacgatcga cgaggacgag gacgaggacg aggacatcga cctcgaggac       420
     accgcgcgta gagatgccgt cgatgcgggc ttctccctcg gttggttctc cagcccgctg       480
     ggaggcaacg acaccggcgc gtacaggttc gtggtcaggg acgacgagcc cgcgggtccc       540
     gccgccgccg cggtcggtcg cgacgggatc gcggtggtca tcgacgagga actccggccg       600
     gtcggtgtcc ttcgaggctc ccccgacgcc atgttcttcg acgtcgacgc caaggttcgg       660
     gaggtgatgg gcatgtcgcc ggctgtcatc gagggtgata ccgcgacggt gggcgacgtc       720
     gcggttgttt gcgccgcagc tgcgcacgat gagccggtgg ccatcacgga ctcggagggc       780
     aggcttcgcc gggtgttgag gcaggaggat ctgctggagc cgatacggag ccagctgagg       840
     gagcagtcgg aatctcgttt cgggaacgcc acgaggtga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page