(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE468

MICSR_1.PE468        Location/Qualifiers
FT   CDS_pept        complement(<930095..>930757)
FT                   /codon_start=1
FT                   /gene_family="HOG000230756" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637386"
FT                   /orf_name="MICPUN_71655"
FT                   /product="Predicted protein"
FT                   /function="phosphoribosylaminoimidazole carboxylase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="ACO62252.1"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="HOGENOM:HBG539656"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniParc:UPI000199AC49"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z5"
FT                   /transl_table=1
FT                   /translation="DFAKLDLGRTARTGLPEVVWGPGKTPEQIAKIMLALRDRQSAVMA
FT                   TRVDPEVYERIRAIEPSIEYDAFARVCTLAGAPDAPPTPVVRGILAVLTAGTADLAVAE
FT                   EAAITARLMGVEDVRLIADVGVAGLQRLLSRLDEVREADVVMVVAGMDGALPSVCAGLV
FT                   DAPVIAVPTSVGYGAAMGGLSPLMATLNSCATGVTVVNIDNGFGATMSAIKMLRAAER"
     gactttgcca agctggacct cggccggacc gcgcgcacgg gcctacctga ggtcgtatgg        60
     ggcccgggaa agaccccaga gcagatagcg aagatcatgc tcgcgctgcg cgaccgccag       120
     tccgcggtca tggcgacgcg cgtcgacccc gaggtatacg aaaggatccg cgcgatcgaa       180
     ccttcgatag aatacgacgc cttcgcgcgc gtgtgcacgc tcgcgggcgc acccgatgcc       240
     ccacccacgc ccgtggtccg cggcatcctc gcagtgctca ccgcgggaac cgccgacctc       300
     gccgtcgccg aggaagcggc gatcaccgct cggctcatgg gcgtcgagga cgtccggctc       360
     atcgccgacg tcggcgtggc ggggcttcag cgactgctgt cgcggctgga cgaggtgcga       420
     gaggcggacg tggtgatggt cgtcgcggga atggacggcg ctctgccgag cgtgtgcgcc       480
     gggctggtgg acgctcccgt catcgcggtg cccaccagcg tcggatacgg cgccgcgatg       540
     ggaggtttaa gtccgctcat ggcaacgctc aactcgtgcg cgacgggggt gacggtggtg       600
     aacatcgaca acgggttcgg tgcgacgatg tcggcgatca agatgcttcg agcagcggag       660
     cga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page