(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE47

MICSR_1.PE47         Location/Qualifiers
FT   CDS_pept        complement(91903..96459)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636052"
FT                   /orf_name="MICPUN_56620"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62053.1"
FT                   /db_xref="UniParc:UPI000199ABA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S4"
FT                   /transl_table=1
FT                   /translation="MPPPRGRGASPFGDPFTFGKPLVLNSQPPTFFGSSLAPPADASAS
FT                   DAPMGGGAVTRSRSARRKVGGYGVTAPAKHGPKDTFTRTTGTDAPSPITGDDRDRPARR
FT                   VAPRVVTKIPVLDDWEPAEDENEDPSVIPPHVDDVPASAAATKAARGRNPARTAETARG
FT                   PAPRRPPPVSSRTTRTTTTKRPASANLREEDERGRNDAAAVVIAARARAKARLAPPRVA
FT                   FGGRPPKKPSPVKRQRHDPDQPPPPDDQQTAADVDVVPRPKPGFSFGVRPNRGGPSLWG
FT                   PGKDSPGPAAYHEGPAPECDQVRGHVPAVTFGAPPDRTRRSGAGWNAGAFPELDPDAPG
FT                   PGEYAGGDDTARVLDKIAGKSRAPAFTFGGGKDDIGKVAAKDFAGAPGPGAYHIDEILA
FT                   VAAERRRIEKGFSFGERVGAAWHEAGPGRDAPAPGTYADGTEVRRSGGGFSFGNAPKTP
FT                   SFIPSSKDGPTPGPGDYLDRKKEKENGGGENDGGDGRTRKSAEGGFTFGWRRPDPAKSA
FT                   TEPGPGAYHRDAQLDDPEALRPGPAFSLGTKLERGGALDGKKDAAKMPGPGDYEVRKSA
FT                   EAGPSYTIFGRPNDGVVVGVDLNEKASLPGPGRYHTPLSPGGRAYTLGSRIEEKDAKRD
FT                   TPAPGEYGAPMPVGAQWGDRNRGFSVLGRDAWAGKGWGEEHAEVPGVGRYDVRGSNSKP
FT                   LPSAPAFTMAGKTKDPTHAPPPTRDIGPGEYDGDGGNRPPSGPSFTIGVRGSKDGAYGD
FT                   LESAAEKPGPGAYPNAPKAKDETRESAPSFTLGRKIDVPDERTKVGPTGFSERPGPGEY
FT                   HADGDVVPPEGPGGFTIYERTKSTEFRPGVDSPGPAYYGGFTTDDVEGGLRMSIHERYE
FT                   SGSVFQHTDRSDTPGPGEYAPEVFQFPVRDDGESTSFVGAPPGYTIGVRRESNYPVRRS
FT                   QIGAPGPGEYHPTEGDGVTDPAWSKGVTIGERRDERARRSLDSRPGPGHYHRTRESIER
FT                   ETGRKAPVPGPKIRDRKPWEREKVLEKKADVPGPSDYDTEPSMKKMDKRAPAHRIGERR
FT                   NDAADRRGSGEGAPGPGEYAGDVVRAPDWRRGATIIADRRERSRASAERRPGPGEYHRD
FT                   APRVAKTGVNIGRGAGKDAPGGVFDAAGRGGPGPGEFEPPPGAIRPGRSTGVNIARGTG
FT                   KDAPGGVFERAGRDVPGPGEHWPDGDAASGRGGRSGGKSVRAPGVKIPATGHDAPGGAA
FT                   VWPEDAPGPGEYHEERTKPVRSAVNIGKASGKDAPGGVFDAALKRGGGPGPGEFESGPG
FT                   ALRQKSTAVNMGKGTGREAPGGAMDRRDGPGPGEFWPDEDPAAPTRGHTQRGIPFGKPP
FT                   KPPRPGAKKSSAPGPGEYAGSVVGAPDARVGPTIPRGKRRGLVSKDARDTPAPGDFEPD
FT                   HHPKTVAGLVREALKRPGSMREPTVPRGGKKAGSERTPGPGEYYSGRGEIRVDRGVKMP
FT                   TREAWERDRDRVKGSGLGPKYHPNHEKVSKPLSVKQPMARADDYADSFRSTRGGSRR"
     atgcccccgc ctcgcggccg aggggcctcc ccgttcgggg atcccttcac gttcggcaag        60
     ccgctcgtgc tcaacagcca gccgccgacg ttcttcggct cgtcgttggc gccccccgcc       120
     gatgcgtcag cctcggacgc tccaatgggc ggaggtgccg tgacgcggtc gcggtccgcg       180
     cgtcgcaagg ttggcggcta cggcgtgacc gcccccgcca agcacgggcc aaaggatacc       240
     ttcacccgca cgacggggac ggacgcgccg tccccgatca ccggggacga ccgggatagg       300
     cccgccagga gggtcgctcc ccgagtcgtg acgaagatcc cggtcctcga cgactgggaa       360
     cccgccgagg atgagaacga ggatccgtcg gtgattccgc cgcacgtgga cgacgtcccc       420
     gcgagcgccg ccgcgacgaa ggccgcgagg ggaaggaacc ccgcgaggac cgcggagacg       480
     gcccgcggcc cggccccgag acgccccccg ccggtctcgt cgaggacgac ccgaacgacc       540
     acgacgaaac gccccgcgtc ggccaatctc cgcgaggagg acgagagagg gaggaacgac       600
     gccgccgccg tggtcatcgc cgcgcgcgcg agggccaagg ctcggctcgc cccgcccagg       660
     gtcgccttcg gcggccgccc gcccaagaaa ccctccccgg tcaagcgcca aaggcacgac       720
     ccggaccaac ccccgccccc cgatgaccaa caaaccgccg ccgacgtcga cgtcgtcccg       780
     agacccaagc ccgggtttag cttcggcgtc cgcccgaatc ggggcgggcc gagcctctgg       840
     ggccccggca aggactcccc gggccccgcg gcgtaccacg agggacccgc gccggagtgc       900
     gatcaggtcc gcggccacgt ccccgcggtg acgttcggcg ccccgccgga tcggacgaga       960
     cgatcgggcg cggggtggaa cgcgggagcc ttccccgagc tggatcccga cgcccccgga      1020
     ccgggagagt acgccggggg cgacgacacg gcccgggtgt tggacaagat cgcgggtaaa      1080
     tcccgcgccc ccgcgtttac ctttggaggg ggtaaggacg acatcggcaa agtcgccgcc      1140
     aaggatttcg ccggcgcgcc gggccccggg gcgtaccaca tcgacgagat cctggccgtc      1200
     gccgcggagc gaaggcgcat cgagaagggg ttcagctttg gggagagggt gggcgcggcg      1260
     tggcacgagg ctggaccggg gagggacgcc ccggctcccg gaacgtacgc ggatggaaca      1320
     gaggttcgaa ggagcggcgg cggcttttcc tttgggaacg cgcccaagac cccgtcgttc      1380
     atcccttcct ccaaggacgg cccaaccccg ggtcccggcg attacctcga caggaaaaag      1440
     gaaaaggaaa acggcggcgg cgagaacgac gggggagacg ggcggacgag gaagagcgcc      1500
     gagggcgggt tcacgtttgg gtggcgccgc cccgacccgg ccaaatccgc gacggagccc      1560
     gggccggggg cgtaccaccg cgacgcacag ctggacgacc cggaggcgct ccgaccgggt      1620
     ccggcgttct ccctgggtac caagctcgag cgcggcgggg ccctggacgg gaaaaaggac      1680
     gcggcgaaga tgccggggcc gggagattac gaggtgcgaa agtccgcaga ggctgggcct      1740
     agttacacga tattcgggag gccaaacgac ggcgtcgtcg tcggcgtgga cctgaacgag      1800
     aaggcctcgc tgcccggccc gggacggtac cacacgcccc tgtctccggg gggcagggcg      1860
     tacacgctgg gttcccgcat cgaggagaag gatgcgaaac gggacacccc cgcgccgggt      1920
     gagtacggag cccccatgcc cgtcggcgcc cagtggggcg atcgcaacag gggcttctcg      1980
     gtgctcggaa gggacgcgtg ggccgggaag ggatggggcg aggagcacgc ggaggtgccc      2040
     ggcgtcgggc gctacgacgt ccgcgggtcc aactccaagc ccctgccctc agccccggcg      2100
     ttcacgatgg ccggcaagac caaggacccg actcacgcgc cgccaccgac tcgcgacatc      2160
     ggaccgggcg agtacgacgg ggacggcggc aacaggccgc cgtccggtcc gagcttcacc      2220
     atcggagtgc gcggttccaa ggacggcgcg tacggggacc tggaaagcgc ggcggagaag      2280
     ccggggcccg gagcgtatcc caacgcgccc aaagcaaaag acgagacccg cgagtccgct      2340
     ccctcgttta ccctcgggcg aaagatcgac gtaccggacg agcgcaccaa ggtgggccct      2400
     acggggttct cggaacgtcc ggggcccggg gagtaccacg cggacgggga cgtcgttccg      2460
     ccggagggac cgggcggctt cacgatttac gagcggacca aatcaaccga gtttcgaccc      2520
     ggcgtcgatt caccaggtcc ggcgtactac gggggtttca ccaccgacga cgtcgagggt      2580
     gggttacgaa tgtccatcca cgagaggtac gagtccggga gcgttttcca gcacacggac      2640
     cggtcggaca cgccggggcc gggtgagtac gctccggagg tgttccagtt tcccgtgcgc      2700
     gacgacggcg agtcgacgtc ttttgtcggc gcgcccccgg ggtacaccat cggcgtcagg      2760
     agggagtcga attacccggt tcgaaggtcg cagatcggcg cacccggtcc gggggagtac      2820
     cacccgacgg agggcgacgg cgtcacggac ccggcttggt cgaagggggt caccatcggc      2880
     gagcgtcgag acgaacgcgc tcgaagatcc ctcgactctc gccccgggcc gggacactac      2940
     cacaggacgc gcgaatccat cgagcgcgag accggtcgca aggcgcccgt acccgggccg      3000
     aagattcgcg acaggaaacc gtgggagcgg gagaaggttc tggagaaaaa agcggacgtt      3060
     ccgggcccgt ccgactacga cacggaaccc tccatgaaaa agatggacaa acgcgcgccc      3120
     gcccaccgca tcggcgagcg gcggaacgac gccgcagacc ggcggggttc gggcgaaggc      3180
     gcccccggcc cgggggagta cgccggcgac gtcgtgcgcg cgcccgactg gcgaaggggc      3240
     gcgacgatca tcgcggatag gcgagagcgg tcgcgagcct ccgcggagcg ccggccgggt      3300
     cccggggagt accaccggga cgccccgcgg gtggccaaga cgggggtgaa catcgggaga      3360
     ggggcgggta aggacgcgcc cgggggtgtc ttcgacgcgg cgggacgcgg gggtccgggg      3420
     cccggggaat ttgaaccccc gcccggcgcc attcggccgg ggaggtcgac gggggtgaac      3480
     atcgcgaggg gcaccgggaa ggacgcgccg gggggcgtgt tcgagcgcgc cggacgcgac      3540
     gtcccggggc ccggtgagca ctggccggac ggggacgccg cgagcggacg gggggggcgg      3600
     agcgggggga aatccgtccg ggcccccggg gtgaagatcc cggccaccgg gcacgacgct      3660
     cccggcggcg ccgcggtttg gccggaggac gccccgggtc cgggcgagta ccacgaggag      3720
     cgaacgaaac cggttcggtc cgcggtgaac atcgggaagg cgtcggggaa ggacgccccg      3780
     ggcggggtct tcgacgcggc gctcaaacgc ggggggggtc ccgggcccgg ggaattcgag      3840
     tcgggtccag gcgcgctccg gcaaaagtca accgcggtga acatgggcaa ggggaccggt      3900
     cgggaagccc cgggcggggc gatggaccgt cgcgacggac cgggcccggg cgaattctgg      3960
     cccgacgagg atcccgcggc tcccaccagg ggacataccc agcgggggat acccttcgga      4020
     aagccgccca agcccccgag gccgggtgcc aaaaaatcat cggcgccggg gccgggtgag      4080
     tacgcggggt ccgtcgtcgg tgcgccggac gctcgagtcg gacccacgat cccgcggggc      4140
     aaacggcgag gtctggtgag taaagacgcg agggacaccc ccgcgcccgg ggacttcgag      4200
     cccgaccacc acccgaagac tgtggcggga ctggttcgcg aggcgctgaa acggccgggg      4260
     tcgatgcgag agccgacggt ccctcgcggg gggaagaagg ccggttcgga gcggacgccc      4320
     gggcccgggg agtactactc cggccggggt gagatccgcg tggaccgcgg ggtgaagatg      4380
     cccacgcggg aggcgtggga gcgggacagg gacagggtga aggggtcggg gctcgggcca      4440
     aagtatcacc cgaatcacga aaaggtctcc aagcctctga gcgtgaagca gcccatggcg      4500
     cgggctgacg actacgcgga ctcgttccga agcacccggg gcgggtcaag gaggtga         4557
//

If you have problems or comments...

PBIL Back to PBIL home page