(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE470

MICSR_1.PE470        Location/Qualifiers
FT   CDS_pept        join(933660..933891,934045..936116)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637388"
FT                   /orf_name="MICPUN_57054"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61830.1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI000199ACBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z7"
FT                   /transl_table=1
FT                   /translation="MSNGWGVLVAKCDKSRSAKHLDRSVDRSGDVTSEPFREQPDIELR
FT                   LTKTIVGRMLMNAEGTSRAQTQVADILIDMPSVSAKHCVITCDEPEGSDTYVITVTDHS
FT                   RHGVQVNKKKISGPTTLSHGDVLTLPFGMDYEFLVLDDGAKPMAPKPAEPKSAKKTPGK
FT                   RAKSVGKASAGKKKGASEDDDAAAKRAKSGDDDSPSATKKLFADDTNALEEAKQLEDAN
FT                   AKLRDELKAAKETIEERDRTIAEHIESAETTKAQYEEALAAAAKEHKAKLAELTADAKS
FT                   HDANVAAMSASCEAAIKSKEEMQAALDRAVAAREGAEKNAAETAAALEEVKAALKDAEA
FT                   AAAAAAEKAAEGSKELEAENASLRAKLEEERTTTAEKAAEIREAREKLEATEADLAVAK
FT                   NDADQLAIKLAEAKASLAAAVKRADEADTCAAPLRASENEARRVCARKEEEAKAMADRL
FT                   AVARMAHKQAMAALKEVGLRLEYDGTGAAAAEADAEATEAEPNTEPPTMDDGAEDAPMD
FT                   ADGVAGATQAAPGDFETEDAIDEEPRETENEGDRIVGMDVLYASVPASEVPASDVPSSM
FT                   DDGSEDEPVPDTELAAPAEGASPVAAMAPPSPREQPESAARHSVGAATQEAAAVLGGGE
FT                   LGGAPAEEEGEEEKEEKEEEAEDVSSGSDAEEKGSESEDTEEVEEEEPEAAGNAVEEPE
FT                   AEEPEADEPEADEPEAEEPEAEEPVEPALVAKVAVPEEEKENSAPVDASVGKELPFSSE
FT                   VEDVAAVPLSFLED"
     atgtcgaatg gctggggcgt cctcgtcgcc aagtgcgaca aatccaggtc cgcgaagcac        60
     ctggacaggt ccgtcgacag gagcggcgac gtcacctcag agcccttcag ggagcagccc       120
     gacattgagc tgcgcctcac gaagacgatc gtggggcgta tgctcatgaa cgcggaggga       180
     acctcccgcg cgcagacgca agttgccgat atcctcatcg acatgccgtc cgtgagcgca       240
     aagcactgcg tcattacctg cgacgagccc gagggctccg atacgtacgt catcaccgtc       300
     acggaccact ccaggcacgg tgtccaggtt aacaagaaga agatctcggg ccccacgacg       360
     ctctcgcacg gcgacgtcct caccctcccc ttcggcatgg actacgagtt cctcgttctc       420
     gatgacggcg ctaaacccat ggcacccaaa cccgcggagc ccaagagcgc aaaaaagacc       480
     ccgggcaagc gcgccaagtc cgtcggcaag gcatcggcgg gcaagaagaa gggcgcctct       540
     gaggacgacg acgctgcggc caagcgcgcc aagtccggcg atgatgactc cccttccgcc       600
     accaagaagc ttttcgccga cgacaccaac gcgctggaag aggcgaaaca gctcgaggac       660
     gctaacgcta aactccgcga cgagctcaag gctgccaagg agacgatcga ggagcgcgat       720
     cgcaccatcg ccgagcacat cgagtcggct gaaacgacca aggctcagta cgaagaagcg       780
     ctcgccgcgg ctgccaagga acacaaggcc aagctcgccg aactcaccgc ggatgccaag       840
     agtcacgatg caaatgtcgc cgcgatgtcg gcgtcctgtg aagccgcgat caagtccaag       900
     gaagagatgc aggcggcgct cgatcgagcc gtcgccgcgc gggaaggggc ggagaagaac       960
     gccgcagaga ccgccgccgc gctcgaagaa gttaaggctg cgctcaagga cgccgaggct      1020
     gccgccgccg ccgccgccga gaaagccgcg gagggatcca aggagctcga agccgagaac      1080
     gcgtcgcttc gcgccaagct cgaggaggaa cgaaccacca ccgccgagaa ggcggctgag      1140
     attcgcgagg ctcgcgagaa actcgaggcg actgaggcgg acctcgccgt cgccaagaac      1200
     gacgccgacc agctcgcgat caagctcgcc gaggctaagg catccctcgc cgccgcggtc      1260
     aagcgcgcgg atgaggccga cacctgcgcc gcgccgcttc gagcctccga gaacgaggct      1320
     cgtcgcgtct gtgcgcgaaa ggaggaggag gcaaaggcga tggccgacag actcgccgtc      1380
     gcgaggatgg cgcacaagca ggcgatggcc gcgctcaagg aggtcggact ccgcctggag      1440
     tacgacggca ccggtgcggc cgccgccgag gctgacgccg aggctaccga ggctgagccg      1500
     aacacggaac ctcccaccat ggatgacggg gcggaggatg cgcccatgga cgcggatggc      1560
     gtcgccggcg ccacgcaggc agcccccggg gactttgaga cggaagacgc catcgacgag      1620
     gaaccccgag agaccgagaa cgaaggcgat aggatagtcg gcatggacgt gctgtacgcg      1680
     tccgtgcccg cgtccgaggt gcccgcgtcc gatgttccct cgtccatgga tgacgggtcc      1740
     gaggatgagc ccgtcccgga cacggagctc gccgctcccg cggagggcgc ctcgccggtc      1800
     gccgcgatgg caccgccgag cccgcgcgag cagcccgagt ccgcggcgcg ccacagcgtc      1860
     ggtgcggcga cacaggaggc cgcggcggta ctcggcggcg gggagctcgg aggggcgccc      1920
     gccgaggagg agggcgaaga agagaaggag gagaaagaag aggaggcgga ggacgtctcc      1980
     tccggatctg acgccgagga gaagggctcc gagtcggagg ataccgagga ggtcgaggag      2040
     gaggagcccg aagctgcggg gaatgccgtc gaggagcccg aggctgagga gcccgaggct      2100
     gatgagcccg aggctgatga gcctgaggct gaggagcccg aggctgagga gcccgttgag      2160
     ccggcgctgg ttgccaaggt tgcggtgccc gaggaggaga aggaaaactc cgcccccgtc      2220
     gacgcgagtg tcgggaagga gttgcccttc agctccgagg tcgaggacgt cgcggcggtg      2280
     cccctctcct ttttggagga ctga                                             2304
//

If you have problems or comments...

PBIL Back to PBIL home page