(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE472

MICSR_1.PE472        Location/Qualifiers
FT   CDS_pept        join(938732..940451,940473..940930)
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637390"
FT                   /orf_name="MICPUN_97165"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO61832.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199ACBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z9"
FT                   /transl_table=1
FT                   /translation="MAFWKPGSKKPEASLPLSAEVDREGPGDSGGRLVVFNRNENLALQ
FT                   AQRERLPIFKTRDAILHLVETRATTVLVGQTGCGKTTQVPQYLVEAGWTAGGRLVACTQ
FT                   PRRVAAMTVASRVADEMGVTLGAEVGYAVRFENVSTPGVTRVRFCTDGVLLRELMEDPL
FT                   LSRYSVVMVDEAHERSLATDLLLGLLKKVQRRRPDLRIIIASATIQAEEFAAFFDTRHL
FT                   EPKPASEASSVNAPSREPGIVSVEGRAHTVLIHYLEKPVPDYVKAAVGAAIDVHRAEGP
FT                   GDVLVFLTGEEEIEAAVSMLQEEAEDNSRRLLGGGAGTNPAGGPERFTVHPLYAGLSPA
FT                   QQMEAFRPAPRYTRKIVVASNVAETSVTIEGVVYVVDCCFVKQKAYDPTRGMESLLTAE
FT                   ASRASANQRAGRAGRVRPGKAYRLCTEKAFRDLPETAPPEMIRSDLAATVLQLKALGID
FT                   NIMNFEWLSPPPAANMIKALELLYALQAIDDDARLTKPLGMHLAELPLEPQLGKALLVS
FT                   GELGCVEEMLTVSAYLQVQTLWVSPRGRQKRLDECRDRFAVAEGDAVTALNIHTAWCGG
FT                   RARSFADKNMLSHRALVRASDIRAQLARHVRRVGLVVSSAGKDSAPVRRAMTAGFFANA
FT                   AALAPHGGGAEGSAFRSVRGGATLFIHPGSVLFRARPAMVVYAAAVRTGREYMRDVTAI
FT                   DPEWLSELAPHFYAMTQRSGNERPADAAAVF"
     atggcgttct ggaagcccgg atcgaagaaa cccgaggcgt cgctccctct gagcgccgag        60
     gttgatcgcg aagggcccgg ggactcgggg gggcggctgg tggtcttcaa tcgcaacgag       120
     aatctcgcgt tgcaggccca gcgggagcgc ctccccatct ttaagacccg cgacgccatc       180
     ctgcacctcg tggagacgcg tgcgacgacc gtgttggtgg ggcagacggg atgcggcaag       240
     accacgcagg tgccgcagta cctcgtcgag gcgggttgga ccgcgggcgg gcggctggtg       300
     gcgtgcaccc aaccccgccg cgtcgccgcg atgaccgtcg cgtcgcgcgt cgcggacgag       360
     atgggcgtca cgctgggcgc ggaggtgggc tacgcggtgc gattcgagaa cgtgtccacc       420
     ccgggggtca cgcgcgtcag gttctgcacc gacggcgtgc tgctgcggga gctcatggag       480
     gatccgctgc tgtcgaggta ctcggtggtg atggtcgacg aggcgcacga gcgttcgctg       540
     gccacggact tactactcgg gctcctcaag aaggtgcagc gccgacgacc ggatctccgg       600
     atcatcatcg cgtccgccac gatccaggcg gaggagttcg ccgctttttt cgacacgcga       660
     cacctcgagc ccaagcccgc ttcggaggcg tcttcggtga acgcgccctc tcgagagccc       720
     gggatcgtct ccgtggaggg cagggcgcac accgtgctga tccactacct cgagaaaccg       780
     gtgccggact acgtgaaagc cgcggtcggg gctgcgatcg acgtgcaccg cgcggaggga       840
     ccgggcgacg tcctcgtctt cctcaccggc gaagaggaaa tagaggcggc ggtgagcatg       900
     ctgcaggagg aggccgagga caactccagg cggttactgg gcggcggcgc gggaaccaac       960
     ccggcgggtg gaccggagcg cttcaccgtg catccactct acgcggggct gtcccccgcg      1020
     caacagatgg aggcgttcag gcccgcaccg aggtacactc gaaaaatcgt ggtggcgagc      1080
     aacgtggcgg agacgtcggt gacgatcgaa ggcgtggtgt acgtcgtgga ctgctgcttc      1140
     gtgaaacaaa aggcgtacga tccgacgcgc gggatggagt ccctgctcac ggcggaggcg      1200
     tccagggcgt ccgctaatca gagggcggga cgagcgggtc gagtcaggcc ggggaaggcg      1260
     tatcgactct gcacggagaa ggcgtttcga gatctgccgg aaactgcgcc gccggagatg      1320
     atccgatcgg acctcgccgc gaccgtactg cagctgaagg cgctgggtat cgacaacatc      1380
     atgaacttcg agtggctctc gccgccccca gccgcgaaca tgatcaaagc gctcgagctg      1440
     ctctacgcgc tgcaggccat cgacgacgac gcccggctca ccaagcccct cggcatgcat      1500
     ctcgccgagc tcccgctgga gccgcagctg ggcaaggcgc tactggtcag cggcgagctc      1560
     gggtgtgtcg aggagatgct gacggtgtcc gcttacctcc aggtgcagac gctgtgggtg      1620
     tcgcctcggg gcaggcaaaa gaggctggac gagtgcaggg acaggtttgc cgtcgcggag      1680
     ggtgacgcgg tgacggcgct caacatacac accgcgtggt gcggaggacg tgcgagatcg      1740
     tttgcggata agaacatgct ctcgcaccgc gcgctggtca gggcttcgga tatcagggcg      1800
     cagctcgcca ggcacgttcg cagggtgggg ctggtggttt cctccgccgg gaaggattct      1860
     gcgcccgtgc gtcgcgcgat gaccgccggt ttcttcgcga acgccgccgc gctggcacct      1920
     cacgggggag gggcggaagg atccgcattt aggtcggtca gagggggcgc gacgttgttc      1980
     attcacccgg ggagcgtttt gttcagggct aggccggcaa tggtcgtgta cgccgccgct      2040
     gttcggacgg ggagggaata catgcgagac gtgacggcga tcgacccgga gtggctgtca      2100
     gaactggcgc cgcactttta cgcaatgacg cagcggagcg ggaacgagcg gccggcggac      2160
     gcagcggcgg tgttttag                                                    2178
//

If you have problems or comments...

PBIL Back to PBIL home page