(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE474

MICSR_1.PE474        Location/Qualifiers
FT   CDS_pept        complement(944680..945765)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637392"
FT                   /orf_name="MICPUN_107932"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase binding"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /protein_id="ACO62253.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0051020"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="UniParc:UPI000199ACBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E201"
FT                   /transl_table=1
FT                   /translation="MLRRLQKSLAGNCPVGTPITPLPANGGDGAHEGKAHVHIIAVEPV
FT                   YSAMDDDASNSHPNSPANSPKAAKFSGGAVGGEEFPVASAFVFDAPFVPQGAPKPSGPE
FT                   AALRITWRCRTTARVDGKFPGLCARLLVTDESTTEMSPASSAAEMLRAQSRAIAAAATA
FT                   WDELRNGATSSAVVGVVGGVSANAAAVDDAASAAAVAGCLGALQRSLQGSLAAGVNGGV
FT                   PAICRAFFPEEESRKRAMSDQSSQTPEIDEEDEESDNTKQEEAVTGSPKPQVDPRAMTS
FT                   EDRSGLLAALEDFLSACARAVEVHGTATRLTAAGKPRGESGASTIEQMQGMFVRCLAEI
FT                   RRDITVISDREKDVDNDEEYK"
     atgctccgcc ggctgcaaaa gtcactggcg ggcaactgcc ccgtcggcac gcccatcacc        60
     ccgctgcccg ccaacggcgg tgacggcgcg cacgagggca aagcgcacgt gcacatcatc       120
     gccgtcgagc ccgtgtacag cgcgatggac gatgacgcgt cgaattctca cccaaactca       180
     ccggccaact ctccaaaggc tgccaagttt tccggcggcg ccgtcggcgg cgaggaattt       240
     ccagtcgcat ccgcgtttgt ctttgacgcg cctttcgtgc cgcagggtgc gccaaagcca       300
     tcgggacccg aggctgcgct gcgcatcacg tggcgttgcc gcaccacggc gcgcgtggat       360
     ggtaagttcc ccgggctgtg cgcccgtctg ctcgtgacgg acgagtccac gacggagatg       420
     tccccggcgt catccgcggc tgagatgctc cgggcgcagt cgcgggccat cgcggcggcg       480
     gcgacggctt gggacgagct gagaaacggc gccacgagca gtgccgtcgt cggcgtggtc       540
     ggcggcgtga gcgcgaacgc cgcggcggtc gacgatgcgg cttccgcggc ggccgtggct       600
     ggatgcctcg gcgcgctgca acgttcgctc cagggaagcc tcgcggcggg cgtcaacggc       660
     ggcgttcccg cgatttgccg cgcgtttttc ccagaggagg aatcgcgaaa gagggcgatg       720
     tccgaccagt catcgcagac gcccgagatt gacgaggagg acgaagagag cgataacacg       780
     aagcaggaag aagccgtgac gggctccccc aagcctcaag tcgatcccag ggcgatgacg       840
     tcggaggacc gctccggttt gctcgcggcg cttgaagatt ttttgtcggc gtgcgcgagg       900
     gcggtcgagg ttcacggcac ggccacgagg ttgactgccg cggggaagcc gaggggcgaa       960
     agcggcgctt cgacgattga gcagatgcag ggtatgttcg tcaggtgcct ggcggagatt      1020
     cgaagggaca tcacggtcat cagcgaccga gagaaggacg tggataatga cgaggaatac      1080
     aagtag                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page