(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE475

MICSR_1.PE475        Location/Qualifiers
FT   CDS_pept        join(952641..952861,953051..954485)
FT                   /codon_start=1
FT                   /gene_family="HOG000264952" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637393"
FT                   /orf_name="MICPUN_105298"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO61834.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG560236"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI000199ACBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E202"
FT                   /transl_table=1
FT                   /translation="MPPVLRPRTPKKGDAPRVKTPGSARPVRREFRNGARAGTGAEDQK
FT                   WSFALSSSGWLFVYYIGVVKALASRGFHRNSKIYGTSGGALTGCLLFLDIDLDALAEYA
FT                   YICAAEARASIRGAFKLRDYCRGAITQFCTANAHEILQGRFEVSITRIFPWYKNLRVNN
FT                   FPTYDFLIQSLMCSACITPLAGFPMWLKGHGLCFDGGVSDFQILKGLARNGTFCKLHCR
FT                   KTNPKDLVVVCPFYSSRANIRPSKYVPIWWAFYPPPPYKLKELFELGQKDAHAWCDKQE
FT                   DAGSSPEKDDSPRATSSEGSRSSDEDDDMEWEWQRKEKAQARGTSDAKDLSRESSVTAD
FT                   DQDMEPPTSPTATNRGFTEWAAECQEWASLSAEAAARRAMSAARAAANKAEAFVHHEAE
FT                   VVHTYASGKFCQAQAAAEAMRRVASKSNLPEIDLIADLDDDDPEEEIPRGRFQAHRLLL
FT                   KSLACMVIYLELVAQTLLNVCGAGAALLLPGVRSGKLREKVFECCRPLPRVLLQPVPGV
FT                   RKVAKIDGKTAKALGNISVAYRVLCYLVHMEVHC"
     atgccgccgg tgttgcgacc gcgcaccccc aagaaagggg atgcgccgcg cgtgaagacc        60
     ccggggtcgg caaggcccgt gcgtcgcgag ttccggaacg gcgcgcgcgc ggggacgggc       120
     gcggaggacc agaagtggtc tttcgccctg agctccagtg gttggctctt cgtctactac       180
     atcggggtgg tgaaggcgtt ggcgtcgcga ggattccaca ggaactccaa gatatacggg       240
     acgtcgggag gtgccctgac gggctgctta ctcttcttag acatagatct ggacgcgctc       300
     gcggagtacg cgtacatctg cgcggccgag gcgcgcgcca gcatcagggg cgcgttcaag       360
     ctgagggact actgccgcgg cgcgatcacg cagttttgca ccgcgaacgc gcacgaaatt       420
     ctgcagggac ggttcgaggt gtccatcacg cgcatcttcc cgtggtacaa gaacctccgg       480
     gtgaacaact tccccacgta cgacttcctc atccagtcgc tcatgtgctc ggcctgcatc       540
     actcctctgg cgggatttcc catgtggctc aagggacacg gcttgtgctt cgacggcggc       600
     gtgagcgatt tccagattct caagggcctc gcgcgcaacg gaacgttctg caagcttcac       660
     tgcaggaaga ccaacccgaa ggatctggtg gtcgtgtgcc cgttctacag cagccgggcc       720
     aacatccggc ccagcaaata cgtgcccatc tggtgggcgt tttaccctcc gccgccgtac       780
     aagctcaagg agctgttcga gctggggcaa aaggacgcgc acgcgtggtg cgataagcag       840
     gaggacgccg ggagctcccc ggagaaggac gattcgccga gggccacgtc atcggagggg       900
     tcgaggtcgt cggacgagga cgatgacatg gagtgggagt ggcagcgcaa ggagaaggct       960
     caggctcgag ggacctcaga cgcgaaggac ctcagccgcg aatcctcggt gaccgcggac      1020
     gaccaggaca tggagccgcc gacgtcgccc acggccacga acagaggttt cacagagtgg      1080
     gcggcggagt gccaggagtg ggcctcgctc agcgcggagg cggcggcgag gcgggcgatg      1140
     agcgcggcgc gagcggcggc aaacaaggcg gaggcgtttg tccaccacga ggccgaggtc      1200
     gtgcacacct acgcgtccgg gaagttttgc caggcgcagg ctgccgcaga ggctatgcgc      1260
     agggtggcgt cgaagagtaa cctgccggag attgacctca tcgcggatct ggacgacgac      1320
     gatccggagg aggagatccc tcgagggagg ttccaggcgc acaggctgct cttgaagtcg      1380
     ttggcgtgca tggtgatcta cctggagctc gtggcgcaga cgctgctgaa cgtgtgcgga      1440
     gccggcgcgg cgctgttact tcccggggtc aggtcgggga agctccgcga gaaggttttc      1500
     gagtgctgcc gaccgctgcc gcgggtgctg ctgcagccgg tgcccggggt gcggaaggtt      1560
     gcgaagatcg acggaaagac ggccaaggcg ctgggtaaca tctcggttgc ctaccgcgtg      1620
     ctatgctact tggtccacat ggaggtccac tgctag                                1656
//

If you have problems or comments...

PBIL Back to PBIL home page