(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE478

MICSR_1.PE478        Location/Qualifiers
FT   CDS_pept        960347..962326
FT                   /codon_start=1
FT                   /gene_family="HOG000265335" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637396"
FT                   /orf_name="MICPUN_99546"
FT                   /product="Glycosyltransferase family 77 protein "
FT                   /function="transferase activity"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="ACO61836.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG560238"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniParc:UPI000199ACC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E205"
FT                   /transl_table=1
FT                   /translation="MQEVDPSKQDHPKWMRDMWSEKVQAVDKNVIDKELEARLESRPPE
FT                   LDHVQPGEELFVTFGTASVTDFVQNWLESADKLGLSPLFVGALDEDMYEWCKKRGVPSM
FT                   LLKGNTVLKNRGQQFITAGDKSFKKMGTVKTKFIQDLLELGIAPILTDADVVWLKDPRS
FT                   YFKRGTYITADVLVSTDCIDVPADRKDNNGCSHVNFNTGVLHFRPTDAAKAFVQTWKTK
FT                   VATSTIAWMRDQPAFNLITHEGVGGHSLEPAVSVPEERRGTEGHRMVYWAANASIRLGV
FT                   LPNWLFGNGHSYFVQWHHLTHPEDGEPFSVHLTYQYGDTGSYAFGKRERMRQAGIWRSD
FT                   PREYFEDGKYLVVSDEGSQVDFSGESPGGEEVGSDRNAYRTAIDRHLREDKLRRTTIRN
FT                   ALALARALNRILVLPEARCYCDKIWNNLNACRAPGAESFKLPYACPMDHIYDLPSWFNP
FT                   GMPDFREPGFLDDPRVPDAIKASVGRVVVDRDGDTRAGKPGWDMNDGKVVKLRHGFTVP
FT                   DAKLALKSLEEKRVIEVDFLGNEGTFCGFGDDAKNKEFDRIVVKPLSASQYYCFTELWE
FT                   DQGSPRGGRNGPYEPQVVLRHCGMMEDDFKRAGKVHAGVVEHIDKPDGGCSCEWGFGLP
FT                   RGLAHISKDESICPRRNSDQPTAG"
     atgcaggagg tggacccgtc caagcaggac catccgaagt ggatgcgcga tatgtggagc        60
     gaaaaggtgc aggcggttga caagaacgtc atagacaagg aactggaggc gaggctcgag       120
     agtagacccc ccgagctgga ccacgtgcag cccggcgagg agctctttgt gacgttcggc       180
     acagcgagcg tgactgactt tgtgcagaac tggctggagt ctgcggacaa gctcggactc       240
     tcgccgttgt tcgtgggagc gctggacgag gacatgtacg agtggtgcaa gaagaggggc       300
     gtgccatcaa tgctcctaaa aggaaacact gttctgaaaa acaggggcca gcagtttatc       360
     accgccgggg ataagtcgtt caaaaagatg gggacagtca agaccaagtt catccaggac       420
     ctcctggagc tgggaatcgc gcccatcctg acggacgcgg acgtggtgtg gctcaaagac       480
     ccgaggtctt acttcaaacg gggaacgtac ataaccgccg acgttctcgt cagcacggat       540
     tgcattgacg tacccgcgga tagaaaagac aacaacggat gctctcacgt caacttcaac       600
     accggcgtgc ttcacttcag gcccacggat gcggcgaagg cgttcgtgca gacatggaag       660
     acgaaggttg cgacgtcgac gatcgcgtgg atgagggacc agcccgcgtt taatttgata       720
     acgcacgagg gcgttggcgg gcactcgttg gaaccagccg tgtccgtgcc ggaagaaagg       780
     cgcggcaccg agggacaccg catggtgtac tgggcggcga acgcgtcgat tcgactcggc       840
     gtgctgccca actggctctt cggcaacggc cactcctact ttgtccagtg gcaccacctg       900
     acgcaccccg aggacggcga gccgttcagc gtccacctca cgtaccagta cggcgacacc       960
     ggctcttacg cgttcggcaa acgcgagcgg atgcgtcagg ctgggatctg gcggagcgac      1020
     ccgagggagt acttcgagga tggaaagtac ctcgtggtct ccgacgaggg atcgcaggtt      1080
     gacttcagcg gggagtcgcc cgggggcgag gaggttggat cggataggaa cgcgtacagg      1140
     acggccatcg atcggcacct gagggaggac aagcttcgaa ggacgacgat acgaaacgcg      1200
     ctcgcgctgg cccgtgccct gaatcgcatc ctcgtcctgc ccgaggcgcg gtgctactgc      1260
     gacaagatat ggaacaacct caacgcgtgt cgcgcgccgg gtgcggagtc gttcaagttg      1320
     ccgtatgcgt gtcccatgga tcacatatac gatctgccct cctggttcaa cccgggtatg      1380
     cccgatttcc gcgagcccgg gtttctggac gacccgaggg tgcccgacgc cataaaagca      1440
     tccgtcggga gagtcgtcgt cgatcgcgac ggggacaccc gtgcgggaaa accgggctgg      1500
     gatatgaatg atggaaaggt tgtcaagttg cgacacggtt tcaccgtccc ggacgctaag      1560
     cttgccctca aatccctcga ggagaagcgc gtgatcgagg tggactttct gggtaacgaa      1620
     gggacgtttt gcgggtttgg agacgacgcg aagaacaagg aattcgacag gatcgtggtc      1680
     aagccgctat cggcgagcca gtactactgc ttcaccgagc tctgggagga tcagggctcg      1740
     ccgcggggtg ggcgcaacgg tccttacgag ccgcaggttg tcctgaggca ctgcgggatg      1800
     atggaagacg actttaagcg cgcggggaaa gtgcacgcgg gggtggtgga gcacatcgac      1860
     aaaccggacg gcggatgttc gtgcgagtgg ggcttcggcc tcccgcgcgg actcgcgcat      1920
     atttccaagg acgagagcat ctgcccgagg cggaactccg atcagcccac tgctggctag      1980
//

If you have problems or comments...

PBIL Back to PBIL home page