(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE479

MICSR_1.PE479        Location/Qualifiers
FT   CDS_pept        complement(962413..963198)
FT                   /codon_start=1
FT                   /gene_family="HOG000264921" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637397"
FT                   /gene_name="TIC55-2"
FT                   /orf_name="MICPUN_57064"
FT                   /product="Chloroplast envelope protein translocase family "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62255.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG560239"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000199ACC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E206"
FT                   /transl_table=1
FT                   /translation="MDSDAAVGPSRSGEWHVVAKSDQLARENARVQVTADGRYLVVARS
FT                   GGRLYAFDATCYHMGAPLLHGDIEDVDGHGACITCPWHHYQISMSTGERLYQDMSRKTC
FT                   TLPKKQRVHEVMEADGEVRVRLSGGGKPPSPPPDVIRPKPHEVDYEWESDRYAFKPPPP
FT                   SQASQKAPRSGKVFNRGGGRFPPGAFGRGSAGLHPGLVGAGVGREVGRMVADSMRGGDG
FT                   KAPWAMSRGFAQPPPKAKPALAGEALAEGEELPDAPGDG"
     atggactctg acgccgccgt gggaccctcc aggtcgggtg agtggcatgt cgtggcgaaa        60
     agcgaccagc tggcccggga aaacgcgcga gtgcaggtca ccgctgatgg ccgatacctc       120
     gtcgtggctc gctcgggcgg caggctctac gccttcgatg cgacgtgcta ccacatggga       180
     gcgcccttac tgcacggcga catagaggat gtggatggac acggcgcgtg catcacttgc       240
     ccgtggcacc actaccagat atccatgtcc accggcgagc gactctacca ggacatgtcg       300
     aggaagacgt gcacgcttcc gaaaaagcag cgggtgcacg aggtgatgga ggcggacggc       360
     gaggtgcgcg tgcggctgag cggggggggt aaaccgccga gtccgccgcc cgacgtgatc       420
     aggcccaagc cgcacgaggt cgactacgaa tgggagagcg ataggtacgc gttcaagccg       480
     ccgcccccgt cgcaggcttc gcagaaggcg ccgaggtcgg gcaaggtgtt caaccgcggc       540
     ggcgggaggt tccccccggg cgctttcggg cggggatccg cgggtctgca cccggggctc       600
     gtaggcgcgg gcgtggggcg cgaagttggg cgcatggtgg ctgactcgat gcgaggcggc       660
     gacggaaagg cgccgtgggc gatgtcgcgc ggtttcgctc aaccgccgcc aaaggcaaag       720
     cccgcgctcg ccggcgaagc actcgcggag ggcgaggagc tcccggacgc cccgggcgac       780
     ggctaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page