(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE48

MICSR_1.PE48         Location/Qualifiers
FT   CDS_pept        97294..97956
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636053"
FT                   /orf_name="MICPUN_99254"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61607.1"
FT                   /db_xref="HOGENOM:HBG560240"
FT                   /db_xref="UniParc:UPI000199ABAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S5"
FT                   /transl_table=1
FT                   /translation="MAEDPYKVLGVKEGTPGDELAKVINRKKLLYKTEPEKLKQMEDAY
FT                   EQIVQASLAARLRGDMSGVSESARKNDLAPSLFGPWAPIPSEAPLKDKKVNIAISVAAV
FT                   LFVWFTPGTIRTIQPIIYATIFHAFRMFMKLVDVDPGPSANIDRDAATKHNNKRFFRAF
FT                   ALVMGTFAVSLGITYWIPNMIFETFRLQVPVWYLLNQEVFVSVIVGGCLAYLTCFYR"
     atggccgagg acccgtacaa ggtgctcggg gtcaaggagg gcacgccggg cgacgagctc        60
     gccaaggtga tcaaccgcaa gaagctgctc tacaagaccg agcccgagaa gctcaagcag       120
     atggaggacg cgtacgagca gatcgttcag gcgtccctcg ccgccaggct ccgcggtgac       180
     atgtccgggg tgtccgagtc ggctcgcaag aacgacctcg cgccttcgct cttcggaccc       240
     tgggcgccga taccttcgga ggcgccgctc aaggacaaga aggtgaacat cgccatctcc       300
     gtcgccgccg tcctcttcgt gtggttcacc ccggggacca ttcgcacgat ccagcccatc       360
     atctacgcca ccatcttcca cgccttccgc atgttcatga agctggtgga cgtggacccc       420
     gggccctccg cgaacatcga tcgcgacgcg gcgaccaagc acaacaacaa gaggttcttc       480
     cgcgccttcg cgctggtgat gggcacgttc gcggtgtccc tcggaatcac gtattggatc       540
     cccaacatga tcttcgagac gttcaggttg caggtgccgg tgtggtatct cctcaaccag       600
     gaggtcttcg tctctgtcat cgtcggcggc tgcctcgctt acctcacctg cttctaccgc       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page