(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE480

MICSR_1.PE480        Location/Qualifiers
FT   CDS_pept        963441..963827
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637398"
FT                   /orf_name="MICPUN_99547"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO61837.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199A5D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E207"
FT                   /transl_table=1
FT                   /translation="MADMVQEIVVAKPVSPVQFMIDYLAVGSSLCQQDKYGLSMMRRAR
FT                   LMKIFKAWDKNQDKTVDLKELRAFTRKHGGNAVTQDELKDIFMDMDESGDSKVDEDEFL
FT                   KFFSLSVKRMDDDEFEQMIQDMLQ"
     atggcggaca tggtccagga gatcgtcgtc gcgaagcccg tctctccggt gcagttcatg        60
     attgactacc tcgcggtggg ctcgtcgctg tgccagcagg acaagtacgg cctgagcatg       120
     atgaggcggg cgcggctgat gaagatcttc aaggcttggg ataagaatca ggacaagacg       180
     gtggacctca aggagctcag ggcgttcacc aggaagcacg ggggaaacgc agtcacgcag       240
     gacgagctca aggacatatt catggacatg gacgagagcg gagacagcaa ggttgacgag       300
     gacgagttcc tcaaattctt ctcgcttagc gtcaagcgga tggacgacga cgagttcgag       360
     cagatgatcc aggacatgct gcagtaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page