(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE481

MICSR_1.PE481        Location/Qualifiers
FT   CDS_pept        complement(964030..964257)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637399"
FT                   /orf_name="MICPUN_57066"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62256.1"
FT                   /db_xref="UniParc:UPI000199A5D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E208"
FT                   /transl_table=1
FT                   /translation="MGGGAVTAVRATEDPTSFNQVVLQAGPLLLPLVLSTSAAVYRSSR
FT                   EGGLARLPLGMWGGICLVWLYWLGSQNGIF"
     atggggggag gggcggtgac tgccgtgcgt gcgactgagg atcccacgtc tttcaatcag        60
     gttgtgcttc aggcagggcc tctgttacta ccgcttgtgc tctccacatc agcggcggtc       120
     tatcggagct ccagggaggg ggggctcgcg aggcttccat tgggaatgtg gggtggaata       180
     tgtctcgttt ggctgtattg gctggggtcc cagaacggca tcttctga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page