(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE482

MICSR_1.PE482        Location/Qualifiers
FT   CDS_pept        964543..965946
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637400"
FT                   /orf_name="MICPUN_57067"
FT                   /product="KH domain-containing protein "
FT                   /function="RNA binding"
FT                   /protein_id="ACO61838.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199A5DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E209"
FT                   /transl_table=1
FT                   /translation="MGDDAQVKEEEGMSPPRGQSRSRSRSRSPRRRSYSPDRRRRRDSR
FT                   DRSRSRSRGRGRSWSRSRSRSPRGYRRRSRSYSRSRSRSRSPPRRRRRSPPRGERDSRR
FT                   PPPGGPARVKAEAEEAIPCVGYEGRIIGRGGETIRRIQEETGARISIDRASGECMVSGS
FT                   TEQVILGSAAVKKIIAEAGERGGGGGGNGGGGGGFRPPSGPFEAEETIPCAGSEGRVIG
FT                   KGGETIRRLQEETGCRIDIEKGSGLCTIKGTVAAVRAAAAAVRRQIEDGDGGGGGFKRK
FT                   RDSEDEPIDSAAYGRELAQREEDDEPKPPPIEPDFGLSGALAAETNTVNGVTLVYTEPL
FT                   EAKKPTVRWRLYVFKNGELQGDPLKIHQQSYYLLGRERKVVDIPTDHPSCSKQHAVIQF
FT                   RARDVMDDDTGDMVQVVTPYILDLDSTNGTHLNGERIDPRKYYQLLEKDTLVFGQSTRE
FT                   FVILNEDSK"
     atgggggacg acgctcaggt gaaagaagaa gaggggatgt cgcctcctcg cggccaatct        60
     cgatcccgct ctcggtcgcg ctcgcccagg cgcaggagct actcgcccga tcgaaggcgg       120
     cgaagggatt cgagggatcg ttcgaggtcg aggtcgcggg ggcggggaag gtcctggtct       180
     cgctctcggt ctagatcgcc ccgcggctac cgccgccggt cgcgctcgta ctcgaggtcc       240
     cgatcccggt cgcgatcgcc gccgcgccga cgccgacgat cgccgccgcg cggagaacgg       300
     gattcacgtc gtccgccgcc cggcggtccc gcgagagtga aggcggaagc cgaggaggcc       360
     atcccgtgcg tcgggtacga ggggcgcatc atcggccggg gcggtgagac catccgccgg       420
     atccaggagg agactggcgc caggatatcc atagatcgag cgtcggggga gtgcatggtg       480
     tccggtagta ccgagcaggt catcctgggg tccgcagccg taaagaaaat catcgccgag       540
     gcgggggagc ggggcggggg cggcggcggt aacggcggcg gcggcggcgg gttcaggccc       600
     ccgagcgggc cgttcgaagc cgaggagacg atcccgtgcg ccgggtccga gggaagggtc       660
     atcggcaagg ggggcgagac catccgccgg ctgcaggagg aaaccggatg caggatcgac       720
     atcgagaagg gttccgggct gtgcacgatc aagggaaccg tcgcggccgt gcgcgcggcg       780
     gcggcggcgg tgaggcgaca gatcgaagac ggcgacggcg gtggaggtgg gttcaagagg       840
     aagagggact ccgaggatga gcccatcgac tcggccgcgt acgggcgaga gctcgcgcaa       900
     cgagaagagg atgacgagcc taaaccgccg ccgattgagc cggactttgg cctctccggc       960
     gcgctcgccg cggagacaaa caccgtgaac ggcgtcacgc tggtgtacac agagccgctg      1020
     gaggcgaaga aaccgacggt gcggtggcgc ctgtacgtgt tcaaaaacgg ggagttgcag      1080
     ggcgacccgc taaagatcca tcagcagtcg tactacctcc tcgggcggga gcgcaaggtt      1140
     gtggacattc ccaccgacca ccccagctgc agcaagcagc acgcggtgat ccagttccgt      1200
     gcgagggatg tgatggacga cgataccggc gatatggtgc aggtcgttac cccgtatata      1260
     ctggaccttg actccacaaa cggcacgcac ctcaacgggg agcgtatcga cccgaggaaa      1320
     tactatcagc tgctggagaa ggacaccttg gtgtttgggc aaagcacgcg cgagttcgtg      1380
     atcctcaacg aagatagcaa gtga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page