(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE483

MICSR_1.PE483        Location/Qualifiers
FT   CDS_pept        complement(966003..968894)
FT                   /codon_start=1
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637401"
FT                   /orf_name="MICPUN_57068"
FT                   /product="Chaperone, Hsp100 family, clpb-type "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein metabolic process "
FT                   /protein_id="ACO62257.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="UniParc:UPI000199A5DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E210"
FT                   /transl_table=1
FT                   /translation="MSAMASNVAGGRVVASAVRRDGNAVRSRRPPGLGEFRPSRPLRSK
FT                   VATRVSADSAKKISQNEFTERAWEAIVLAPEIASNSQQQIVETEHLCKAMFEQKDSFAL
FT                   RILTQAGVDPSAAVGFIDRFISRQPKVSGGAQQVLGRHLEALVEEARVRRSAMRDDFVA
FT                   VEHLVLAICKDERVGNALMAELGLNEDALKNAVTKLRGGTNVTDQGAEGKYESLKRYAR
FT                   DLTAEARAGKLDPVIGRDDEIRRTIQILSRRSKNNPVLIGEPGVGKTAISEGLAQRIVQ
FT                   GDVPLSLQGVQVMSLDMGLLIAGAKFRGEFEDRLKAVMKEVTDSDGGIILFIDEIHTVV
FT                   GAGGSGGSGGGMDAGNLLKPMLGRGELRCIGATTLDEYRQYIEKDPALERRFQKVLIDQ
FT                   PSVEDAISILRGLRERYEIHHGVSISDNALVEAAVLSDRYIADRFLPDKAIDLVDEAAA
FT                   KLKMEITSKPTVLDEIDREILKLQMEQLSLRRPAGSRPSEQANVSARLQRVESELASLM
FT                   VRQDTLTFQWEQEKAKLAAIQQLKEEIDAVQTEVSQAERDYDLNKAAELKYGSLMNLQR
FT                   ELLDAEAAMDAAAAQGGDLLRDEVTESDIADIISKWTGIPVSKLQEGEREKLLNLPAEL
FT                   HKRVVGQDLAVQAVTEAIQRSRAGLSDPNRPIASFMFLGPTGVGKTELAKTLATFLFNT
FT                   EEAMVRIDMSEYMEKHAVSRLIGAPPGYVGFEEGGQLTEAVRRRPYSVVLFDEMEKAHG
FT                   DVFNVLLQILDDGRVTDSQGRVVNFKNAILIMTSNIGSQFVLENMNDNSEGGKAYRRER
FT                   VMEAVRGHFRPEFVNRVDEYIVFDPLDFNQVRKIVEQQVERVRSRLKDRKIGLRVDESA
FT                   IQMLCEAGYDPSFGARPVKRAVQHLLETSLAQAILRGDVAENEQAVVWAHGEGEGRQLL
FT                   VAKEEGQRQEEPAQQELNGADPYAQMSWDQTPQ"
     atgtctgcca tggcatcgaa cgtcgcgggc ggtcgcgtcg tcgcgtccgc cgtccgccgc        60
     gacggcaacg cggtgcgatc tcgacgcccg cccggcctcg gcgagtttcg tccctctcgc       120
     cctcttcgct ccaaggtggc gacccgcgtg tccgcggaca gcgccaagaa gatctcgcag       180
     aacgagttca ccgagcgcgc gtgggaggcg atcgtactgg cgccggagat cgcctccaac       240
     tcgcagcagc agatcgtcga gaccgagcac ctgtgcaagg ccatgttcga gcagaaggac       300
     tccttcgcgc tccgcatcct gacccaggct ggcgtcgacc cctccgcggc ggtcggcttc       360
     atcgatcgtt tcatctccag gcagccgaag gtgagcggcg gcgcgcagca ggtgctcggt       420
     cgccacctcg aggccctcgt cgaggaggcc cgcgtccgca ggtccgccat gcgcgacgac       480
     tttgtcgccg tcgagcacct cgtcttggcc atctgcaagg acgagcgcgt cggcaacgcg       540
     ctcatggccg agctcggcct caacgaggac gccctcaaga acgcggtgac caagctcagg       600
     ggtggcacca acgtcaccga ccagggcgcc gagggcaagt acgaatccct caagaggtac       660
     gcgagggatc tcaccgcgga ggcgcgagcg ggtaagctcg accccgtcat cggtcgagac       720
     gacgagatcc gaaggaccat ccagatcctc tccagaagga gcaagaacaa ccccgtgctc       780
     atcggtgaac ccggcgtggg taagaccgcc atctccgagg gactggcgca gaggatcgtg       840
     cagggcgacg tgcctctctc gctccagggc gtgcaggtga tgtcgctgga catgggcctc       900
     ctcatcgcgg gcgcaaagtt ccgcggagag tttgaggaca ggctcaaggc cgtgatgaaa       960
     gaggtgacgg attccgacgg cggcatcatc ctcttcatcg acgagatcca caccgtggtc      1020
     ggcgcgggcg gcagcggcgg cagcggcgga ggcatggacg ccggtaacct cctcaagccg      1080
     atgctcggcc gcggtgagct ccgatgcatc ggcgccacca ccctcgatga gtatcggcaa      1140
     tacatcgaga aggacccggc gctcgagcgt cgtttccaga aggtactgat cgatcagccc      1200
     tccgtcgagg acgccatctc catcctccgc ggtttgaggg agaggtacga gattcaccac      1260
     ggcgtcagca tcagcgacaa cgcgctggtc gaggcggctg tgctctcgga ccggtacatc      1320
     gccgacaggt tcctgcccga taaggcgatc gacctcgtgg acgaggctgc cgccaagctc      1380
     aagatggaga tcacgtccaa gcccaccgtc ctggacgaga tcgaccgcga gattctcaag      1440
     cttcagatgg agcagctctc gctccgcaga cctgccggat ccaggccgtc ggagcaggcc      1500
     aacgtttccg cgcgtctcca gcgcgtggaa tccgagctcg cgtcgcttat ggtccgtcag      1560
     gacacgctca cgttccaatg ggagcaggag aaggccaagt tggctgcgat ccagcagctc      1620
     aaggaggaga tcgacgccgt gcagacggag gtgtcgcagg ctgagcgcga ctacgacctc      1680
     aacaaagccg ccgagctcaa gtacggctct ttaatgaacc tccagcgtga gctgctcgat      1740
     gctgaggcgg cgatggacgc cgccgcggcg cagggcggcg acctgctccg cgacgaggtc      1800
     accgagtccg acatcgccga catcatctcc aagtggacgg gcatccccgt ctccaagctt      1860
     caggagggcg agcgcgagaa gctcctcaac ctacctgccg agctccacaa gcgcgtcgtg      1920
     gggcaggacc tcgcggtaca ggcggtcacg gaggctattc agcgctcgcg cgcgggatta      1980
     tccgatccca accgcccgat cgcgtcgttc atgttcctcg gacccaccgg cgtcggcaag      2040
     actgagctcg caaagactct cgccacgttc cttttcaaca ccgaggaggc catggttcgc      2100
     atcgacatga gcgagtacat ggaaaagcac gcggtgtcca ggctcatcgg cgcccctccc      2160
     ggttacgtgg gcttcgagga gggcggacag ctcaccgagg ctgtccgacg caggccctac      2220
     agtgtcgtcc tcttcgacga gatggagaag gctcacggcg acgtgttcaa cgtgctgctt      2280
     cagatccttg acgacggacg cgtgaccgat agccagggcc gggtggtgaa cttcaagaac      2340
     gctattctga tcatgacgtc caacatcggc tcccagtttg tgctcgagaa catgaacgac      2400
     aacagcgagg gcggtaaggc ttacaggagg gagagggtga tggaggctgt ccgcgggcac      2460
     ttccgaccag agtttgtcaa ccgcgtcgac gagtacatcg tgttcgaccc cctcgacttc      2520
     aaccaggtga ggaagatcgt cgagcagcag gtggaacgcg tgcgatccag gctcaaggac      2580
     cgcaagatcg gcctgcgcgt ggacgagtcg gcgatccaga tgctatgcga ggctggctac      2640
     gatcccagct ttggcgcgag gccggtgaag cgcgcggtgc agcacctgct ggagacatcc      2700
     ttagctcagg ctatcctccg cggcgacgtc gccgagaacg agcaggcggt cgtgtgggcg      2760
     cacggagagg gtgaggggag gcagctcctc gtcgcgaagg aggaaggtca gaggcaggag      2820
     gagcctgcgc agcaggagct caacggcgca gacccttacg cgcagatgtc ctgggaccaa      2880
     accccccagt ga                                                          2892
//

If you have problems or comments...

PBIL Back to PBIL home page