(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE485

MICSR_1.PE485        Location/Qualifiers
FT   CDS_pept        970536..971945
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637403"
FT                   /orf_name="MICPUN_57070"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO61839.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A5DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E212"
FT                   /transl_table=1
FT                   /translation="MSGFHTEDGYNGPSLFGQNGAIVGGVRNKLGHVASEEEKQQARRT
FT                   VVVIGIKWLLSPGWRGDDYRDAVFPAEVAQWFEEQIGPVQAVHFKPPVQAWVEFNSASN
FT                   ATAALNLNGATYPRKCKHSPGGRIKVSRATHTELVRGAKDHLRSYHVLIPEKFLKGEVE
FT                   PGAHDGAGDGRAGEKEGEDDEAKVIAALRESNPYFDQDMALYEEHHREKLRAEFDRLAR
FT                   ERSELEEVKRLYRGASAGDVDAIESAIWAGADTDTANPLDGGRTALHYACLAGERAAAQ
FT                   VLVEHGANPSALDALGFTPADALKSGEKDPRGEIAGDLELARAAHAHMASLAMKINAGT
FT                   YDVDEPDAPDSMPPLHEAVAARKGALTRFLLAQGASVEKTGGSDGDTPLHIAARTGQER
FT                   MCRLLVLRGAAPDAPAAGGDGSTPLHEALRGVKRNGSKGAHAKIAKLFMDEMKRLGRGA
FT                   EAAAIIAGTRS"
     atgtcggggt tccacaccga ggatgggtac aatgggccaa gcctgtttgg ccagaatggc        60
     gccatcgtcg ggggcgtacg caacaagctc ggccacgtgg cgtccgagga ggagaagcag       120
     caggcgaggc gcactgtggt cgtcatcggg atcaagtggc tcctctcgcc ggggtggagg       180
     ggcgacgact acagggatgc ggtatttccc gcggaagtgg cgcagtggtt cgaggagcag       240
     atcggtccgg tgcaggctgt gcactttaag cccccggtgc aggcgtgggt cgagtttaac       300
     tccgcctcga acgccaccgc ggcgttgaat ctcaacgggg cgacgtaccc tcgaaagtgc       360
     aagcattcgc ccggcggcag gatcaaggtg agccgcgcga cgcacacgga gctggtccgt       420
     ggcgccaagg atcacctgag aagctaccac gtgctcatcc cggagaaatt tctcaagggc       480
     gaggtggagc cgggtgcgca cgacggggcc ggggacggac gggcggggga aaaggagggg       540
     gaggacgacg aggcgaaggt cattgcggcg ttgcgcgagt ccaatccgta tttcgaccag       600
     gacatggccc tgtacgagga gcatcacagg gaaaaactgc gagccgagtt cgacaggctg       660
     gcgcgggagc gttcagagct cgaggaggtc aagcggctgt accgaggagc gagcgccggt       720
     gacgtcgacg cgatcgagag cgccatatgg gccggagcgg atacggacac cgccaacccc       780
     ttggacgggg ggcggaccgc gctgcactac gcgtgcctcg ccggggaacg agccgcggcg       840
     caggtgctcg tggaacacgg ggccaatccc agcgcgctgg acgccctggg gtttacgccc       900
     gcggatgcgt taaaaagcgg tgaaaaggat ccgcggggcg agatcgccgg cgacctcgag       960
     ctcgcgagag ccgcacacgc gcacatggcc tcgctcgcga tgaagatcaa cgccggtacg      1020
     tacgacgtgg acgagcccga cgcgccggac tcgatgccgc cgctgcacga ggctgtcgcc      1080
     gctcgtaaag gggcgctgac gcggttcctg ttggcgcagg gggcgagcgt ggagaaaacc      1140
     ggggggtccg acggcgacac cccgctgcac atcgccgcgc gcacgggtca ggagaggatg      1200
     tgcaggctgc tcgtgctgag gggtgccgcg ccggacgcgc ccgccgcggg aggggacggg      1260
     tcgacgccgc tgcacgaggc gctgaggggg gtgaagcgca acggctcgaa gggcgcgcac      1320
     gcgaaaatcg caaagctctt catggacgag atgaagcggc tcggccgggg cgcggaggcg      1380
     gcggcgatca tcgccggtac gcgttcttaa                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page