(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE486

MICSR_1.PE486        Location/Qualifiers
FT   CDS_pept        complement(972004..972663)
FT                   /codon_start=1
FT                   /gene_family="HOG000220986" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637404"
FT                   /orf_name="MICPUN_80283"
FT                   /product="Predicted protein"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62259.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG713289"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="UniParc:UPI000199A5DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E213"
FT                   /transl_table=1
FT                   /translation="MSAVSAAAVKELRDKSGAGMMLCKKALTECNGDMEEAVKWLRKKG
FT                   MASADKKAGRVAAEGAIHSYIHGGSRLGVLVEVNCETDFVARGDKFKELVADIAMQVAA
FT                   SPGVEYVSPEDADPAMVAAEKELMMKMEDVVSKPENIREKIIQGRLSKVVNEKALLKQP
FT                   FIKDPSKTVEQLIKEVTAEIGEKISVRRFVKYNLGEGIEKKVEDFAAEVEATRTAT"
     atgagcgccg tgtcggcggc ggctgtaaaa gagcttcgcg acaagtctgg cgccggcatg        60
     atgctctgca agaaggcgct cacagagtgc aacggcgaca tggaggaggc ggttaagtgg       120
     cttcgcaaga agggcatggc gtcggcggac aagaaggcgg gtcgcgtcgc cgcggagggt       180
     gccatccact cctacatcca tggggggtcc cgcctcggcg ttctcgtcga ggtcaactgc       240
     gagaccgact ttgtggcgcg cggcgacaag ttcaaggagc tcgtcgccga catcgccatg       300
     caggtcgccg cctcccccgg tgtcgagtac gtctcgcccg aagacgcgga cccagccatg       360
     gtcgccgccg agaaagagct catgatgaag atggaggacg ttgtctccaa gcccgagaac       420
     atcagagaga agatcatcca gggccgcctc agcaaggttg tgaacgagaa ggcgctcctc       480
     aagcagccct tcatcaagga tccgtccaag acggtcgaac aactcatcaa ggaggtcacc       540
     gcggagattg gagagaagat ctccgtccgc cgtttcgtca agtacaacct cggtgaaggc       600
     atcgagaaaa aggtggaaga ttttgccgcc gaagttgaag ccaccaggac cgcaacctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page