(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE487

MICSR_1.PE487        Location/Qualifiers
FT   CDS_pept        join(975993..976128,976414..977645)
FT                   /codon_start=1
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637405"
FT                   /orf_name="MICPUN_80247"
FT                   /product="Predicted protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61840.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG699365"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000199A5DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E214"
FT                   /transl_table=1
FT                   /translation="MAPFGSKVPLAEPSWYQNLNTPYYNASHVAWRAKLRDFFEKEVEP
FT                   IVDDWDKQASMNNHAACGEYVKRMYAKSAQYGILPACVGKPWPGKYTSAAEPEGYDYFH
FT                   ELINVDEGTRAGGGIAWAMMGGLGIGMPPVLNFGVPGDRALQDRVVRECLAGEKIICLC
FT                   ITEPGAGSDVANLACTAEDKGDHFLVNGNKKWITNGIYADYFTVAVRTGPPGSAHKGLS
FT                   MLLIERNSSPGITTSKMDCMGVWPSGTTYIEFDNVKVPKKNVVGRVGDGFKQIMYNFNH
FT                   ERWLLAAQAARMARTCVEESIAFARSRRTFGKFLIEHQAIQHKIGEMARQCEGLQAWLE
FT                   NVTFQMNTMSKEEQNRKLGGHIALLKLSSSRVAEFCASNAMQVLGGAGYTRSGKGTKVE
FT                   RIYREVKAYAIPGGSEEIMLNLAAGQFGFVTRRAPDPRDKIIKQLKDELKRVHSKI"
     atggctccat tcggtagcaa ggttccgttg gccgagccct cgtggtacca gaacctcaac        60
     acgccgtact acaacgctag ccacgtcgcg tggcgtgcca agctccgcga ctttttcgag       120
     aaggaggttg agccgatcgt cgacgactgg gataaacagg cgtccatgaa caaccacgcc       180
     gcgtgcggcg agtacgtcaa gcgcatgtac gccaagtccg cccagtacgg catcctgccc       240
     gcgtgcgtgg gcaagccgtg gccgggtaag tacacgagcg ccgccgagcc ggaggggtac       300
     gattacttcc acgagctcat caacgtcgac gagggcaccc gcgcgggcgg tggcatcgcg       360
     tgggccatga tgggcggcct gggcatcggc atgccgcccg tcctcaactt tggcgtcccc       420
     ggcgatcgag ctctgcagga tcgcgtcgtg cgcgagtgcc tcgcgggcga gaagataatc       480
     tgtctctgca tcaccgaacc cggcgcgggt tccgacgtcg ccaacctcgc gtgcaccgcc       540
     gaggacaagg gcgaccactt cctcgtcaac ggcaacaaga agtggatcac caacggcatc       600
     tacgccgact acttcacagt cgccgtgcga accggcccgc cgggctctgc gcacaagggc       660
     ctctccatgc tgctcatcga gcggaactcc tccccgggga tcaccaccag caagatggac       720
     tgcatgggcg tgtggcccag tggcaccacc tacatcgagt tcgacaacgt caaggtgccc       780
     aagaagaatg tcgtcggcag ggtcggcgac gggttcaagc agatcatgta caacttcaac       840
     cacgagaggt ggctcctcgc cgcgcaggct gcgaggatgg ccaggacctg cgtcgaggag       900
     tccatcgcgt tcgcgcgatc caggcgcacc ttcggtaagt tcctcatcga gcaccaggcg       960
     atccagcaca agatcggcga gatggcgagg cagtgcgagg gcctccaggc gtggctcgag      1020
     aacgttacgt tccagatgaa cacaatgtcc aaggaggagc agaaccgcaa gctcggcggg      1080
     cacatcgcgc ttctaaagct ttcgtcctcg agagtcgccg aattttgcgc ttccaacgcc      1140
     atgcaagtcc tcggcggtgc ggggtacacc cgcagcggca agggcaccaa ggttgagcgc      1200
     atctaccgcg aggtcaaggc ttacgccatc ccgggcggaa gcgaggagat catgctgaac      1260
     ctggccgcgg gtcagttcgg gttcgtcacg cgcagggcgc cggatccgag ggacaagatc      1320
     atcaagcagc tgaaagatga gctcaagcgc gtccactcca agatctga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page