(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE488

MICSR_1.PE488        Location/Qualifiers
FT   CDS_pept        join(977864..978909,979111..980788)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637406"
FT                   /orf_name="MICPUN_99553"
FT                   /product="Predicted protein"
FT                   /function="sulfotransferase activity"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61841.1"
FT                   /db_xref="GO:0008146"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniParc:UPI000199A5E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E215"
FT                   /transl_table=1
FT                   /translation="MATTGDAREAEPLLGGGDTGAPASWWPRGRVGALVAGAMLVLLGL
FT                   CAGSAVGPMPTGLSRLGDDDAAPAPTYPAAEEPPLLDPLVSFNTPRCRQTRASLARVTN
FT                   HDGDVVVIPELRAVYVDIVKAASESIRSALEDNFHASWSADLGQYKHPVTGRPQRSSTS
FT                   YLTDDVLANYTFFTFVRDPNTRFRSSYEQAICRERCTLCTARGAGTMYTPTIAEITAFL
FT                   QGRLMHFYGDIALRGERSDEITLQEAWVDEHFESQILRLSGATKDGTPVPLNFVGRVES
FT                   FEHDWARLMDHLGVKEGDPRRVTPGHQEHACDIPERGKVVQRQRASPVTTLEKVAVAAL
FT                   YHDDFECLGIMASWKDGLEGLRERNVTELACVMMSSQKPPYSAEVLEEARKSARKVEGG
FT                   FASRSKHAKEYAAKVAAKKGDLVKKIVKVMPEGVQKEHYQEAIATAAMIDKAAAEAEAQ
FT                   AKTEVKPEVKVEVKPEVKVEVKPEVETEAKPMDVDPPSQQPSSQGTILRQPSDTAAAMA
FT                   QVEKEPLIKTILRRVLERHEIKYHLSTLELDAKRKYSAKAASAVSHAMKKYNEHVEARN
FT                   AKLPPAQRKPGLGEAALVEHITSQAHKMLLAKLKEAAEPKKEEPPAAPKPGDASFVPAA
FT                   RPPGMEGKSFDDLVQYWKRLGELRVAYLPRVRQTLPMLQKYSRGVGQVAANAENFAKMT
FT                   EHTLIPLLSQTADEPMMTAKFTMDELAALEGHVKKLVALAGGRGVNEVPAPAPAAPKPA
FT                   PADEATAGDTKRKRDGEEEEDGEGGDRKRAKTEDAPEPEPEPEPMPAPRAPSAFTGLTS
FT                   CAPDHAHAQPAPPMPSALEGTSEKRPPGKSVGCPVAAEEGELVAAAVYSSDDVSYWAPD
FT                   GELLRRALEGEVIAGTTKSAAMFKAFEELKEVFSSA"
     atggcgacca cgggcgacgc gagggaggcg gagcccctcc tgggaggggg cgatacgggc        60
     gcgcccgcgt cgtggtggcc caggggtcgc gtcggggccc tggtcgccgg cgcgatgttg       120
     gtgctcctcg ggttgtgcgc gggttccgcg gtcggaccga tgcccacggg gctctcccgg       180
     ctgggcgacg acgacgcggc ccccgcgccg acgtacccgg ccgcggagga accgccgctg       240
     ttggacccct tggtatcgtt caacacgccg cggtgtcgac agacgcgcgc gtcgctcgcg       300
     cgggtgacca accacgacgg cgacgtcgtg gtcatccccg agctccgcgc ggtgtacgtc       360
     gacatcgtca aggccgcgtc cgagtccatt cgctcggcgc tcgaggacaa cttccacgcc       420
     agctggagcg cggatttggg acagtacaag catccggtca ccggtagacc gcaaaggagc       480
     agcacgtcct acctcaccga cgacgtgctc gccaactaca ccttcttcac cttcgtcagg       540
     gaccccaaca cccggttccg gtcgtcgtac gagcaagcca tctgcaggga gcgatgcacg       600
     ctgtgcaccg cgaggggcgc gggtaccatg tacacgccga cgatcgccga gatcaccgcc       660
     tttttacagg gaaggttgat gcatttctac ggcgacatcg cgctgagggg tgagaggtcg       720
     gatgagatta cgctgcagga ggcgtgggtg gacgagcact tcgagtcaca gattcttcgg       780
     ctgagcggcg cgaccaagga tggcacgccg gtgcctttga acttcgtggg gcgggtggag       840
     agcttcgagc acgattgggc gcgactcatg gaccacctcg gagtcaagga aggggacccg       900
     cggcgggtca cgccgggtca ccaggagcac gcgtgcgaca tcccggagcg aggtaaggtc       960
     gtgcagaggc agcgcgcgtc gccggtgacc acgctggaga aggtggcagt cgcggcgctg      1020
     taccacgacg acttcgagtg cctggggatc atggcgtcct ggaaggatgg actcgagggt      1080
     cttcgcgaaa gaaatgtgac agagctcgca tgcgtcatga tgtcctccca gaagcccccg      1140
     tactccgcgg aggtcctgga ggaggcgcgc aagtccgcga ggaaggtgga gggcgggttc      1200
     gcgagcagga gcaagcacgc gaaggagtac gcggccaagg tggctgcgaa gaagggcgac      1260
     ctggtcaaga agatcgtcaa ggtgatgccc gagggagtgc agaaggaaca ctaccaggag      1320
     gcgatcgcca ccgcggcgat gatcgacaag gcggcggccg aggcggaagc ccaggcgaag      1380
     accgaggtga agccggaggt gaaggtcgag gtgaagccgg aggtgaaggt cgaggtgaag      1440
     ccggaggtgg agacggaggc caagcccatg gacgttgacc caccgtcgca gcagccttcg      1500
     tcccagggta ccatccttcg gcagccgtcc gacaccgccg cggcgatggc gcaggtcgag      1560
     aaggagcccc tcatcaagac gatccttcga agagttctgg aacgccacga gatcaagtac      1620
     cacctctcaa cgctcgagct cgacgccaag aggaagtact cggccaaagc cgcgtccgcg      1680
     gtatctcacg cgatgaaaaa gtacaacgag cacgtggagg cgaggaacgc gaagcttcca      1740
     cccgcgcagc gcaagccggg cctgggagaa gcggcgctcg tcgagcacat cacctcgcag      1800
     gcgcacaaga tgttgctcgc caagttgaag gaggcggccg agcccaagaa ggaggagccc      1860
     cccgccgcgc ccaagcccgg cgacgcgtcg ttcgtgcccg ccgcgcgtcc ccccgggatg      1920
     gagggcaaga gcttcgacga cctcgtccag tactggaaac ggctcggcga gctccgggtc      1980
     gcgtacctgc cccgggtcag gcagaccctc ccgatgctcc agaagtacag caggggcgtc      2040
     ggtcaggtgg cggcaaacgc ggaaaacttc gcgaagatga ccgaacacac gctgattcca      2100
     ctgctgtcgc agacggcgga tgagccgatg atgacggcca agttcaccat ggacgagctg      2160
     gcggcgctcg agggacacgt gaagaaactg gtggcactcg cgggtggccg cggggtgaac      2220
     gaggtgcccg cgcccgcgcc cgcggcgccc aaaccggcac cggcggacga ggcgaccgcg      2280
     ggtgatacca agaggaagcg cgacggggaa gaggaggagg atggggaagg cggcgaccgg      2340
     aagcgggcca agacggagga cgcaccggag ccggagccgg agccggagcc gatgccggcc      2400
     ccgcgtgcgc cgtccgcgtt cacgggtctc acgtcgtgcg cgccggatca cgcgcacgcg      2460
     cagcccgcgc cgccgatgcc gtccgcgctc gagggtacgt ccgagaagag gccgcccggg      2520
     aagagcgtcg gttgcccagt cgccgcggag gagggagagc tcgtcgcggc ggcggtgtac      2580
     tccagcgacg atgtgtcgta ctgggcgccg gacggggagc tgctgcggcg cgcgctggaa      2640
     ggggaggtga tcgcggggac gacgaaatcg gcggcgatgt tcaaggcgtt tgaggagctg      2700
     aaggaggtgt tctcgtcggc gtga                                             2724
//

If you have problems or comments...

PBIL Back to PBIL home page