(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE489

MICSR_1.PE489        Location/Qualifiers
FT   CDS_pept        complement(980875..981240)
FT                   /codon_start=1
FT                   /gene_family="HOG000100029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637407"
FT                   /orf_name="MICPUN_80239"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62260.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG560246"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI000199A5E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E216"
FT                   /transl_table=1
FT                   /translation="MPEAGGNLSAVRGEDQFGRTLWEKGKNGALVVVKYGAAWCKHCPM
FT                   MLPEFGAAARRHPEAHFVLADVDTLPETGKDIRFTPTFSFYRSGVKLDEITRTSPQQLR
FT                   DHVWMHAPDKPYVPDDA"
     atgccggaag ccggaggcaa cctgagcgcg gtgcgcgggg aagatcaatt cggtaggacg        60
     ctctgggaga agggcaagaa tggcgcgctg gtggtggtca aatacggcgc cgcgtggtgc       120
     aaacactgcc cgatgatgct cccggagttt ggtgccgcgg cgcgtcggca cccggaggcg       180
     cacttcgtcc tcgcggacgt ggacacccta ccggaaaccg gcaaggacat caggttcacg       240
     cccacgtttt cgttttaccg cagcggcgta aagctcgacg agatcacgcg cacgtcgccg       300
     cagcagctga gggaccacgt ctggatgcac gcgccggaca agccgtacgt gccggacgat       360
     gcgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page