(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE49

MICSR_1.PE49         Location/Qualifiers
FT   CDS_pept        98198..99427
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636054"
FT                   /orf_name="MICPUN_56622"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxygen transport"
FT                   /protein_id="ACO61608.1"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniParc:UPI000199ABAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S6"
FT                   /transl_table=1
FT                   /translation="MFSSLASSSVLSLATAPNVGGGRRLRPARGFARDTPFPIRGATLL
FT                   VPSDVSRLVLARASDVREGDYASEDSYDGDDDGAWEGMSSSRNRSATVIRTAGRDDMYL
FT                   EVDLPAHNMGITFTCGPDATIAMVEKVRQDSAAEQAGIEIGDILFSCSAVELTGSDTPV
FT                   VVGDSEGTDTHWRRIDNFRCLGQPFDVQMAAFNSTAIVDAGFKHRIVRAIFRRDVNPDG
FT                   RSRASRLDEMLGDEKAATDDPTEKDAETSVAKLVSESWKDIVSAVTIEGFGELLFKSLF
FT                   RHDWDLVRLFPFRDCESWEEVRAHPKFQSHAVNVAGAIDKAVSLLGNSSELVPVLRGLG
FT                   ERHHGYGVEEEHYDLLGSALLEALEEGTALSGVSPGGRGWTRELGDAWTETWATVAATM
FT                   KGDLYGTSPR"
     atgttctcat cgctcgcgtc gtcttcggtt ctttcgctcg cgaccgcccc gaacgtcggg        60
     ggaggtcgtc gtctccggcc cgcccgcggg ttcgcgcgcg atacgccgtt tccgatccgc       120
     ggcgcgacgc ttctcgtccc gtccgatgtt tctcgcctcg tcctcgcccg agcctccgac       180
     gtccgcgagg gggattacgc ctccgaggat tcctacgacg gggacgacga cggcgcgtgg       240
     gaggggatga gctccagtcg gaaccgaagc gcgacggtca ttcgcaccgc gggtcgcgac       300
     gacatgtacc tggaggtgga cctccccgcc cataacatgg gaataacctt cacctgcgga       360
     cccgacgcca cgatagcgat ggtcgagaag gtgcggcagg acagcgccgc ggagcaggcg       420
     ggcatcgaaa tcggtgacat cctcttctcc tgctccgccg tcgagctcac cggctccgat       480
     actcccgtgg tcgtcgggga ctcggaggga accgacacgc actggaggcg gatcgacaac       540
     ttcaggtgcc tcggccagcc gttcgacgtc cagatggccg cgttcaactc gaccgccatc       600
     gtcgacgcgg ggttcaagca caggatcgtc cgcgcgatat tcaggcggga cgtcaacccc       660
     gacgggcgat cgagggccag tcgcctcgac gagatgctcg gcgatgagaa agccgcgact       720
     gatgacccga cggaaaaaga cgccgagacg tccgtggcca aactcgtgag cgagtcctgg       780
     aaagacatcg tctccgcggt cacgattgag ggattcggcg aactcttgtt caagtcgctg       840
     ttccgacacg attgggatct ggtccggctc tttccgttca gggactgcga gagctgggag       900
     gaggtgaggg cgcacccaaa gtttcagtct cacgccgtca acgtagccgg cgcaatcgac       960
     aaagccgtgt ccctgctcgg gaactcgtcc gagctggtgc ccgtgctccg ggggctggga      1020
     gagaggcacc acggctacgg cgtcgaggag gagcactacg acctcctggg ctcggcgctg      1080
     ctcgaggctc tcgaggaagg caccgcgctc tcgggggtat ccccgggggg caggggttgg      1140
     acgcgggagc tcggcgacgc gtggaccgaa acttgggcaa ccgtcgccgc gaccatgaag      1200
     ggcgatctgt acggaaccag cccgaggtga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page