(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE490

MICSR_1.PE490        Location/Qualifiers
FT   CDS_pept        981450..982292
FT                   /codon_start=1
FT                   /gene_family="HOG000282238" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637408"
FT                   /orf_name="MICPUN_79551"
FT                   /product="Predicted protein"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="ACO61842.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG730251"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020552"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI000199A5E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E217"
FT                   /transl_table=1
FT                   /translation="MAEIDHAACLVAAELAARAAGEEIKAAWDAERDVEYKGTVDLVTA
FT                   TDKKCEDLIFDMLQSKFPTHAFVGEESVAAADGKLPEIGDEPTWFVDPLDGTTNFVHAF
FT                   PFSCVSIGLAVKKKPVIGVVFNPISNECFTAVVGNGARLNGKPISVSKVSDLGKALIGT
FT                   EIGVSRDAATVDAIMGRVRACVENARSLRCSGSCAMNMVGVAMGRLDGFYEIGFGGPWD
FT                   CVGAAVIVTEAGGVVCDPSGKPFELTARRVLCGNPDIAPALTKVLTAIPDGPLEPQAP"
     atggccgaaa tagaccacgc cgcgtgcctc gtcgccgctg agcttgcggc gcgggccgcc        60
     ggcgaagaga tcaaggcggc gtgggacgcc gagcgcgatg ttgagtataa gggcaccgtc       120
     gatctggtga ccgcgacgga taagaaatgc gaggacctca tcttcgacat gctccagagc       180
     aagttcccga cgcacgcgtt cgtcggggag gaatctgtcg cggcggcgga cggcaagctc       240
     ccagagatcg gcgatgaacc cacgtggttc gttgatcccc tcgacggcac cacgaacttc       300
     gtccatgcgt ttcccttctc gtgcgtctcc atcgggctcg cggtgaaaaa gaagcccgtg       360
     atcggcgtgg tgttcaatcc catctcgaac gagtgcttca ccgcggtcgt gggcaatggc       420
     gctaggctca atggcaagcc gatatcggtc agcaaggtat cggatctcgg caaagcgctg       480
     atcggcacgg agatcggcgt cagcagggac gccgccaccg tcgacgccat catgggcagg       540
     gtgagggcct gcgtggagaa cgctcggtcg ctccgatgct cgggctcgtg cgcgatgaac       600
     atggtgggcg tcgccatggg acgactggac gggttctacg agatcgggtt cggcggtccg       660
     tgggactgcg tgggcgcggc ggtgatcgtg accgaggcgg gcggagtggt gtgcgatccc       720
     agcgggaagc ccttcgagct gaccgccagg cgggtgctct gcgggaaccc ggacatcgcg       780
     ccggcgctca cgaaggtcct gaccgccatc ccggacgggc cgctggagcc gcaagcgcct       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page