(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE492

MICSR_1.PE492        Location/Qualifiers
FT   CDS_pept        join(complement(985080..985451),complement(984255..985028))
FT                   /codon_start=1
FT                   /gene_family="HOG000264978" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637410"
FT                   /orf_name="MICPUN_79531"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62262.1"
FT                   /db_xref="HOGENOM:HBG409849"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199A5E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E219"
FT                   /transl_table=1
FT                   /translation="MLAQEKLVPKPPIRTTVGYNFEHDNDLREAYRNPWNEVRIGRVLE
FT                   DLDSLAGNIAFAHCDDADVATRPQLLVTASVDRVRLLRPLRLKEDMTLTGAVAWVGTSS
FT                   IVIRMEAWPADHPDAPTDPDPGPSLTADFTFVARDSVTNKGAPVNPLVPETDEQRDLFE
FT                   RTARRVEAKRARMRSERTNGADGALSPELAESKRLFVEDVTRAARALRELPALAPAQDV
FT                   AMDATRTENMFVAQPQQRNLSGRIFGGFLLRRAFELAFATTYVFGGAKPKFHSVADMNF
FT                   LRPVEVGDLMRIRARVLHATRTSCGRPSVDVEVEALVTKPESLRSEVSNTFMFKFDVGD
FT                   ANEGRVVRRVLPSSREEAAHVWEKCVRPDVQARLEEQTPLI"
     atgctcgctc aggagaagct ggtcccaaaa cctcccatca ggacgacggt gggctacaat        60
     ttcgagcacg acaacgacct gagggaggcc taccgcaacc catggaacga ggttaggatc       120
     ggcagggtgc tcgaagacct cgacagccta gcgggaaaca tcgccttcgc gcactgcgac       180
     gacgcggacg tcgccacgag gccccagctc ctcgtcaccg cgtccgtgga cagggttcga       240
     ctgctgcgac cgctccggct gaaggaggac atgaccctca cgggcgccgt cgcgtgggtg       300
     ggcacgtcgt ccatcgtcat tcgcatggag gcgtggcccg cggatcatcc cgacgcgccg       360
     acggacccgg accccggacc gagcctcacc gcggatttca cgtttgtcgc gagggactcg       420
     gtgaccaaca agggagcgcc ggtgaacccg ctggttcccg aaacggacga gcagcgggac       480
     ctgttcgaac gcaccgcgcg gcgcgtggag gcgaagaggg cgaggatgcg gtcggagcga       540
     acgaacggcg cggacggcgc gctgtcgccc gagctggcgg agagcaagcg cctctttgtg       600
     gaggacgtca cgcgcgcggc gagggcgctg agggagcttc ccgcgctggc acccgcgcag       660
     gacgtggcca tggacgcgac gcgcaccgag aacatgttcg tggcgcagcc gcagcagcgc       720
     aacctgagcg gtcgcatctt cggtggcttt ctccttcgcc gggcgtttga gttggccttt       780
     gccacgacgt acgtcttcgg cggcgccaag ccaaagtttc actccgtcgc cgacatgaac       840
     ttcctcaggc cggtggaggt tggagacctg atgcggatcc gcgcgagggt gctccacgcg       900
     acgcgtacgt cgtgcgggcg tcccagcgtg gacgtggagg tggaggccct cgtgacgaaa       960
     cccgagtcgc ttcggtccga ggtgagcaac acgttcatgt tcaagtttga cgtcggcgac      1020
     gcgaacgagg gaagggtggt gaggagggtg ctgccgtcgt cgagggaaga ggctgcgcac      1080
     gtgtgggaaa aatgcgtgcg gccggacgtc caggcgaggc tcgaggagca aacgccattg      1140
     atatag                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page