(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE493

MICSR_1.PE493        Location/Qualifiers
FT   CDS_pept        985948..987432
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637411"
FT                   /orf_name="MICPUN_112704"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61843.1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199A5E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E220"
FT                   /transl_table=1
FT                   /translation="MSSEPSPSPPTAICLTIKNLTKRDFTLGEVPLALTVGELKARIES
FT                   EYEGNPPPNTQRIVYAGALLRDESAGLADVVKASDLEAGAVVFHLVLPAEASSTASTPA
FT                   STPGATPASAREPGAETSTPSSAPSPADGRLPAQPGTPPPAPRADQQSAYPPQPEATPA
FT                   FGFSNQPPPATTQPGSSRPTTPGMTPTVAAYPPPYAGLGAHSPHVQAVYASAYAAAFNS
FT                   LSPGGSPAPGAPVAVPVPVPVFGFGGGWGAPGWGAPGWNGAPGGYQQHGAPGQQQHHAV
FT                   LAPGQQQPTTPTPPRFDLNDPDQAARAVAQAVRDGDPVAAAAAAAAAAAGGRPVHVMQI
FT                   HIDLRLIMKLAMIVAVASQGATNVRMAIYAAMAVVVYLFQTGAVAWVIRRFLPDILDEQ
FT                   ADGMVGGMGAVGGGGAGRAGGAAAPPPRRRPPQGPRTNAVLPGMRDGMPRSWFGEIKVL
FT                   VCGFLASLLPSWQPPELYRHPRPGAAAAGPERPHQD"
     atgtcgtcgg aaccctcccc gtcgccgccc acggcgatat gcctgaccat caagaacctc        60
     acgaagcgag acttcacgct cggcgaggtg cccctcgcgc tgaccgtggg cgagctcaag       120
     gcgcggatcg agtcggagta cgagggaaac ccgccgccca acacgcagcg catagtgtac       180
     gccggcgcgc tgctcaggga cgaaagcgcg gggctggcgg acgtggtcaa ggcttcggat       240
     ctggaggctg gcgcggtggt gtttcatctg gtgctccccg cggaagcctc gtccacggcg       300
     agcacgcccg cgagcacgcc gggtgcgacg ccggcgagcg cgcgagaacc cggtgccgaa       360
     acatccacgc cctcgagcgc gccatcgccc gcggacgggc gcctccccgc gcagccgggg       420
     accccaccgc ccgcgcctcg agcggatcag cagtccgcgt acccgccaca gcccgaggcg       480
     acgcccgcgt ttgggtttag caatcaaccg ccccccgcga cgacccaacc cggatcgagt       540
     cgaccgacca ccccggggat gacgcccacc gtcgcggcgt accctccccc ttacgcgggc       600
     ctgggcgcgc actcgccgca cgtgcaggcc gtctacgcgt ccgcgtacgc cgccgcattc       660
     aactcgctga gccccggcgg gtcccccgcg cccggagcgc ccgtcgccgt gcccgtcccg       720
     gtgcccgtgt ttggctttgg cggcgggtgg ggcgcgccgg ggtggggcgc gcccgggtgg       780
     aacggagccc cgggcgggta ccagcagcac ggtgcgccgg ggcaacagca gcaccacgcg       840
     gtgctcgcgc cggggcaaca gcagccgacg acgccgacgc cgcctcgatt cgacctgaac       900
     gatcccgacc aggcggcgcg ggcggtggcg caggcggttc gcgacggaga tccggtggcc       960
     gccgccgcgg ctgccgcggc ggcggcggcg ggggggcgac cggtgcacgt gatgcagatt      1020
     cacatcgacc tgaggctgat catgaagttg gcgatgatcg tggcggtggc gtctcagggc      1080
     gctacaaacg tgaggatggc gatttacgcg gcgatggctg tcgtcgtgta cctgttccag      1140
     acgggcgcgg tggcgtgggt gattcgtagg ttcctcccgg acatcctcga cgaacaagcg      1200
     gacggtatgg tcggtgggat gggcgcggtc ggcggcggtg gtgcggggcg cgcgggagga      1260
     gcagcggcgc ccccgccgcg gcgtcgaccg ccgcagggac ctcgaacaaa cgctgtgctc      1320
     cccggcatgc gcgacgggat gcccaggagc tggttcgggg agatcaaggt tctggtgtgc      1380
     ggttttctgg cgtcgctcct gcccagctgg cagccgccgg agctgtacag gcatccccga      1440
     cccggggctg ccgccgccgg gccagagcgc ccacatcagg attga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page