(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE495

MICSR_1.PE495        Location/Qualifiers
FT   CDS_pept        complement(989040..992651)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637413"
FT                   /orf_name="MICPUN_99558"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62264.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000199A659"
FT                   /db_xref="UniProtKB/TrEMBL:C1E222"
FT                   /transl_table=1
FT                   /translation="MEEAAPRAAPLQRLGPALRAVLGCDPKALRRAMDSRAAGDGGASS
FT                   GGGKSVKMARELTDALDDIAAFLAADVAEDADSGAAAAYPAVDPMLEHVVRPANGGVAA
FT                   GIDATAKSKKVALRIVAWLLASSPRGAGDECAARVGAALARRCAPPTPKRTRLAACIAL
FT                   HHAAVNLVDGLPPSCSPDAIAPGLLATAAEAGEGDAPTRLQAEAADTLLAITTRLAVVD
FT                   HRALWRALPHLRAVTESVGGWWPAACRAPRIAAREAYTRLRRVEDTGDAEAWSRALANA
FT                   WMDWAPLLAVRGGLDGITAGAVGRDVDTAVGGEVPSPSHGAGDGVESAQARQLARWLET
FT                   AAAAASAERTGGHGATAAASERLAHALVAVGLLVGRAGLAGGGESGDAHARAALRNRAA
FT                   DALVPALGSRSGAARDLAASIAACAIGGGWGAEHAALLDGSLAALDDASAVGDVRSTYS
FT                   GVASLASALVAAEPRAVGFGGTRPGLARVLRTCEHGRTEEARAGALAVIRNVLETAAPG
FT                   EDVVVGSEAAAITAASLGALKDPTLVVRKAAAATFSALPIPDVLPRLLRALSAKDARER
FT                   ASARESAAGAMRAYTETRGASAALDAFIAAVRPGPGEGDVVSGVSENDAEGSRATSVLR
FT                   GWSESLTEDQAREVAAGIAAATLRNPGVTALVRVASALAPRVGEPPACRETFAAVRAAW
FT                   SASRPAEASEASEASSNADDVFERLAPLLVLRTLPLEAWDDDHLFSVDESPSVPDVLLD
FT                   IALAGAGEHDEVRRVAAELHGRAHPDATSESRGVRLAEAVVDGALGRARACMFSLCSSL
FT                   AFRGIDACPSHSSTASPAATREVCARILESLGMDDSDEATKTRMGATETLASLVRAELE
FT                   DADVDRPGDDTDGDDDEPLSLGDEPRGGRAEGGLLEPADGFGQSPLTKSLANIYVDPLA
FT                   APTPAARREPLIRVLDGDDGTENVTENVTETGTENVTETGTETIPPRDGSRPTRRRRSA
FT                   TLNGILAALQGSSAPDWTRPADGNPGAATRIRLTLADVLVSVARRPLRDADAAAAFADR
FT                   ALPALAAVAGGSGSAACEKATEKATADANRRDPCDATRAAAFHVAMVAVAPVTGDGEPS
FT                   GGFRVSGGGRVASHARLLAASCASTLRSSGDVHDSVRVAAARLVTALVAGDDDTLEALA
FT                   GSIPEVRSALRSAVDTAESEELADSCRRLLTCMGAVA"
     atggaggagg cggcgccgcg ggccgcgccc ctgcagcggc tcggaccggc gctacgtgcg        60
     gtgttgggat gcgatcccaa agcgttgcgt cgcgcgatgg attcccgcgc ggcgggcgac       120
     ggcggggcgt cgagcggtgg cggcaaatct gtgaagatgg cgcgagagct cacggacgcg       180
     ctcgacgata tcgccgcgtt cctggcggcc gacgtcgccg aagatgccga ctcgggcgcg       240
     gcggcggcgt atcccgcggt ggatccgatg ctcgaacacg tcgttcgtcc cgcgaacggc       300
     ggcgtcgcgg ccgggataga cgcgacagcc aagtcgaaga aggttgccct ccgaatcgtc       360
     gcgtggttgc tcgcctcgtc gccgcgaggc gcgggcgacg agtgcgccgc gcgcgtcggc       420
     gccgcgctcg cgcgtcgctg tgcaccgccg acgccgaagc gcacgaggct cgccgcgtgc       480
     atcgcgcttc accacgccgc cgtgaacctc gtcgacggct tgcccccgtc gtgctcgccg       540
     gatgcgatcg cccccggact cctcgccacc gccgcggagg cgggcgaggg cgacgcgcct       600
     acccgactcc aggcggaggc tgccgacaca ctcctcgcga tcaccacgag gctcgccgtc       660
     gtcgaccacc gcgcgctgtg gcgggcgctg ccccaccttc gagcggtgac ggaatccgtc       720
     ggcgggtggt ggccggcggc gtgccgagcg ccgaggatcg cggcgaggga ggcgtacacg       780
     cgactgcggc gcgtcgagga cacgggggac gcggaggcgt ggtcgcgcgc gctagcgaac       840
     gcgtggatgg actgggcgcc gctgctcgcg gtgcgggggg gactggacgg gatcacggcc       900
     ggcgctgtcg ggcgcgacgt cgacacagct gtcggcggcg aggtcccgtc gccaagtcac       960
     ggggccgggg acggggtcga atccgcgcag gcgcgccagc tcgcgagatg gctggaaacc      1020
     gccgcggcgg ccgcctctgc cgaacgaacc ggtgggcacg gggcgaccgc cgcggcgagc      1080
     gaacggctcg cgcacgcgct cgtcgccgtc ggcctgctcg tcggtcgggc gggcctcgcg      1140
     ggtggcgggg aaagcggcga cgcacacgcg agggcggcgc tgaggaatcg agccgcggac      1200
     gcgttggtgc ccgcgctcgg gtcccggagc ggcgccgcgc gtgacctcgc ggcgtccatc      1260
     gcggcgtgcg ccatcggcgg cggatggggc gcggaacacg ccgcgttact ggacggctca      1320
     ctcgccgcgc tcgacgacgc gtcagccgtc ggcgacgttc ggtccacgta ctcgggcgtc      1380
     gcctcgctgg cctcggcgct cgtcgcggcc gagccacgcg ccgtgggttt tggcgggacg      1440
     cgaccaggcc tcgcgcgcgt gcttcgaacg tgcgaacacg gacggaccga ggaagcgcgg      1500
     gcgggtgcgc tcgcggtgat ccggaacgtt ctggagacgg cggcgcccgg cgaagacgtc      1560
     gtcgtcgggt cggaggcggc ggcgataacc gccgcgtcgc tgggggcgct gaaagacccg      1620
     acgttggtcg tgaggaaagc cgcggcggcg acgttctccg cgcttccaat cccggacgtc      1680
     ctcccccgcc tcctccgcgc attatccgcg aaggacgcga gggaacgggc ctccgcgcgg      1740
     gagagcgcgg cgggcgccat gcgagcgtac acggaaacac gcggggcgag cgcggctctg      1800
     gacgcgttca tcgccgccgt gcgacctgga ccgggtgagg gcgacgtggt aagcggggtg      1860
     agcgaaaacg acgccgaggg ttcgcgcgcg acgtctgtcc tccgcgggtg gtccgaaagc      1920
     ctcacggagg atcaggcgcg cgaggtcgcc gcgggtatcg ccgccgcgac gcttcgtaac      1980
     ccgggcgtga cggcactcgt ccgcgtcgcg tccgcgctcg cgccgcgggt cggggagccg      2040
     cccgcgtgca gggagacctt cgccgcggtg cgcgccgcgt ggtcggcttc gagacccgct      2100
     gaggcgtctg aggcgtctga ggcgtcgtcg aacgcggacg acgtgttcga gcgcctcgcg      2160
     ccgcttctgg tgctgcgaac gctaccgctg gaggcttggg acgacgacca cctcttctcc      2220
     gtcgacgagt ccccgtccgt tcccgacgtt ctcctcgaca tcgccctcgc cggcgccggc      2280
     gagcacgacg aggtgcgcag ggtcgccgcc gagctgcacg gtagggcgca tccggacgcc      2340
     acgtctgagt cgcgcggcgt gaggctcgcc gaggcggtcg tcgacggcgc gctcggccgg      2400
     gcacgcgcgt gcatgttctc gctgtgctcg tcgttggcgt ttcgcgggat agacgcgtgt      2460
     ccctcgcact cgtcgaccgc gtcaccggcg gcgactcgcg aggtttgcgc gcgaatcctc      2520
     gaaagtttgg gtatggacga ttccgacgag gcgacaaaga cgcggatggg cgcgacggag      2580
     acgctcgcgt cgttggtccg cgccgagctc gaggacgccg acgtcgatcg tcccggcgac      2640
     gacaccgacg gggacgacga cgagcctctg agcctcgggg acgagccgcg gggcggtcgc      2700
     gccgaaggcg ggctactcga gcccgcggac ggctttggac aaagcccgct gacaaagtcg      2760
     ctcgcgaaca tctacgtcga cccgctcgct gcgccgacgc ccgccgcccg acgcgagccg      2820
     ctcatccggg tgctcgacgg cgacgacggg acggagaacg tgacggagaa cgtgacggag      2880
     accgggacgg agaacgtgac ggagaccggg acggagacga ttcccccgcg cgacgggagt      2940
     cgtccgacga gacgcaggcg aagcgcgacg ctgaacggaa tcctcgccgc cctgcaggga      3000
     tcctccgcgc cggactggac ccgccccgcg gacggaaacc ccggcgccgc gacgcgaatc      3060
     cgcttgaccc tcgccgacgt cctcgtctcc gtcgctcgaa ggccccttcg ggacgcggac      3120
     gcggcggcgg cgtttgcgga ccgagcgcta cccgcgctcg ccgccgtcgc cgggggttcc      3180
     ggctctgctg cgtgcgaaaa agccaccgaa aaagccaccg ccgacgcgaa ccgtcgcgac      3240
     ccgtgcgacg cgacgcgcgc cgcggcgttc cacgtcgcga tggtcgccgt cgcgcctgtc      3300
     accggtgacg gcgagccgtc cggtgggttt cgcgtgagcg gcggcggacg cgtcgcgtcg      3360
     cacgcgaggt tgctcgccgc cagctgtgcg tcgacgctcc ggagttccgg ggacgttcac      3420
     gattcggttc gcgtcgcggc ggccaggctg gtcaccgcgc tcgtcgcggg ggacgacgat      3480
     acgctggagg cgctggcggg gtcgatcccg gaggtgagga gcgcgctgag aagcgcggtg      3540
     gacacggccg agtccgagga gctggcggac tcgtgccgac ggctgctcac ctgcatggga      3600
     gcagtggcct aa                                                          3612
//

If you have problems or comments...

PBIL Back to PBIL home page