(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE50

MICSR_1.PE50         Location/Qualifiers
FT   CDS_pept        complement(99580..102867)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636055"
FT                   /orf_name="MICPUN_56623"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62054.1"
FT                   /db_xref="UniParc:UPI000199ABAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S7"
FT                   /transl_table=1
FT                   /translation="MPSRFPHGGEDAPLLAGDSRGRGGNAKKSDSGADRLLSRGVTALA
FT                   ALLLIGLCVMLGVHLMGSYHSADSDLSNKDRSWIETLDDGTKILHGADGKLSIVSGDAG
FT                   KKSSKHHKKKKGTDDILDLLHNENAKGSIEGEIDPNKDIASQQNDILLNKEKEMMDQLT
FT                   AMAKGKGGPDAKGSSKKPSVNPAEAAEKMLAGGNAPTTSTFDPRAALRHHEEALEHLST
FT                   KDKKANENLKLTDQEKSELEQLEELTRKPPPGPPAYVTPEEQLLHKAAMKAKKHDEKGA
FT                   EDWYNQLDDSVDVFEVRNQALIELEEASHKKDDKKGAEGVESTKASAKHAAKASAKAKA
FT                   TKPSAEPIASTELEPVASTEPEPVASTEPEPVADKEGEVAKTGEDELEADVELADTEPE
FT                   PEPEPEPVEPFGAHDSEAKNDDEDGPDPAEPIEPFGAHDSKVEAEPEADDDDEPVEPVE
FT                   PFGHDDEKDAEPVEEKPDAVEEEAEAAEKEEEPEPVAAKAEDPEPAANAEKEEEPEPVA
FT                   AKEEEPEPAAAAEKEEEPEPAAAADPTSAAPASDAGDKHPTPEQIKWWKDHHPNGAALG
FT                   HRTRNRRPVSRRPRHEAEAALGVAPSNPKASSVPASRWSGVDLAQHLSCSDSLADPATG
FT                   KTFDVATEFYMSDETTLGPNGEAIKLGPRARAVRDTTFVSAFLRVDGPGAPDPTRYLTG
FT                   VRHAACNAGRARLNSVFFADSPEMCAHVRRLYDNGRALSNELAPPVPRLGSGKFRCQVK
FT                   AVKNLPLKPATGLRPEAVIGGCANSANAFVWYNKVNFMVDAAEMCESDPDAEKTSQFAW
FT                   FDGDVAGPGALKALLAHPLDPAALVAGAKDEKVHFTCHPRAVREAQAVEPCRAGETMVM
FT                   PRVFSGTPQALRGFKRRWDAYMHRYVPLSTHTAAELGQWRMARGFFADYKNPPNAARGA
FT                   GLKPVEAAIAVNTRSGGWTCPCPSEEYVMNRLLNDEMFPEEKQFSGGKIAMLVTQEEKA
FT                   REEEKAQLTAKGGDAVAGMGGPRRPAAQAGVGTASSFSLRRGLGLLEDGLNAAALGAEA
FT                   IESDVPGKQFIDASPDGTDGSCARSEDGTPSGFAELPSMGLISWRFN"
     atgccatcgc gattccccca cggcggcgag gacgccccgc tgctcgccgg cgactcccgc        60
     ggccgcggcg gcaatgccaa gaaatcggat tcgggcgccg acaggctcct gagccgtggc       120
     gtgaccgcgc tcgccgcgct gctgcttatc ggcctgtgcg tgatgctcgg cgtgcatctc       180
     atgggctcgt accactccgc tgatagcgac ctgtcgaaca aggacaggtc ctggatcgag       240
     accctcgacg acggcaccaa gatcctgcac ggcgcggacg gcaagctctc catcgtgtcc       300
     ggcgatgccg gcaagaagtc cagcaagcac cacaagaaga agaaggggac cgacgacatc       360
     ctcgacctcc tccacaacga gaacgccaag ggctccatcg agggcgagat cgacccgaac       420
     aaggacatcg cgtcgcagca gaacgacatc cttctcaaca aggagaagga gatgatggac       480
     cagctcaccg cgatggccaa gggcaaaggt ggccccgacg ccaaagggtc ctcgaagaag       540
     ccctcggtga accccgcgga ggctgccgag aagatgctcg cgggcggtaa cgcccccacg       600
     acctccacgt tcgacccgcg cgccgcgctc aggcaccacg aggaggccct ggagcacctc       660
     tccacgaagg acaagaaggc caacgaaaat ctcaagctca ccgaccagga aaagtcggag       720
     ctcgagcagc tcgaggagct cacgcgcaag cccccgccgg gcccgcccgc gtacgtcacc       780
     cccgaagaac agctcctcca caaggcggcg atgaaggcga agaagcacga cgagaagggc       840
     gccgaggatt ggtacaacca gctcgacgat tccgtggacg tcttcgaggt tcgaaaccag       900
     gcgctgatcg agttggagga ggcatcgcat aagaaggacg acaagaaggg cgccgagggt       960
     gtcgaatcga ccaaggcgag cgccaagcac gcggcgaagg cgagcgccaa ggcgaaggcg      1020
     actaagccct cggccgagcc catcgcttcg actgagctcg agcccgtcgc ttcgactgag      1080
     cccgagcccg tcgcttcgac tgagcccgag cccgtcgctg ataaggaagg tgaggtggcc      1140
     aagacgggcg aggatgagct cgaggctgat gtcgagctcg ccgacaccga acccgagccg      1200
     gaacccgagc ccgaacccgt cgagcccttc ggcgctcatg attccgaggc gaagaacgat      1260
     gacgaggacg gccccgaccc ggccgagccc atcgagccct tcggagctca cgactcgaag      1320
     gttgaggcgg agcccgaggc tgacgacgac gacgagcccg tcgagcccgt cgagcccttc      1380
     ggacacgacg acgagaagga cgcggaaccc gtcgaggaga agcccgacgc cgtcgaggag      1440
     gaagccgaag ccgccgagaa ggaggaggag cccgagccag tggcggcgaa ggcagaggat      1500
     cccgagcccg cggcgaacgc cgagaaggag gaggagcccg agcccgtggc ggcaaaggag      1560
     gaggagcccg agcccgcggc ggccgccgag aaggaggagg agcccgagcc cgcggctgcc      1620
     gccgacccca cctccgcggc tcccgcttcg gacgccggag acaagcaccc caccccggag      1680
     cagatcaaat ggtggaagga ccaccacccc aacggcgccg cgctcggcca ccgcacccgc      1740
     aaccgccgcc cggtgagtcg ccgcccccgc cacgaggccg aggccgcgct cggggtcgcc      1800
     ccgagcaacc ccaaggcgtc gtccgttccc gcctcgaggt ggtccggcgt cgacctcgcg      1860
     cagcacttgt cgtgctccga ctcgctcgcg gaccccgcga ctggtaaaac cttcgacgtc      1920
     gcgacggaat tttacatgtc cgacgagacc accctgggtc ccaacggcga ggcgatcaag      1980
     ctcggcccga gggccagggc cgtccgcgac accaccttcg tctccgcttt cctccgcgtg      2040
     gacggtcctg gggcgccgga cccgacgcgg tacctcaccg gggtgcgaca cgcggcgtgc      2100
     aacgcgggcc gagctcggct caactcggtc ttcttcgccg attccccgga gatgtgcgcg      2160
     cacgtgcgaa ggctgtacga caacggtcgc gcgctctcca acgagctcgc gccgcccgtc      2220
     ccgaggctcg ggtccggcaa gttccggtgc caggtgaagg ctgtcaagaa cctcccgctc      2280
     aagcccgcga cgggcttacg gcccgaggct gtcatcggcg gctgcgccaa ctcggccaac      2340
     gcgttcgtgt ggtacaacaa ggtcaacttc atggtggacg ccgcggagat gtgcgagtcg      2400
     gacccagacg ccgagaagac gagtcagttc gcgtggttcg acggggacgt cgcgggaccc      2460
     ggcgcgctca aggcgctcct ggcgcacccg ctcgaccccg ccgcgctcgt cgcgggagcc      2520
     aaggacgaga aggtgcactt cacgtgccac cccagggcgg tccgcgaggc ccaggcggtg      2580
     gagccgtgcc gcgccggaga gacgatggtg atgccacgcg tcttctcggg caccccccag      2640
     gctttgcgcg ggttcaagcg aaggtgggac gcctacatgc acaggtacgt tccgctgtcc      2700
     acgcacaccg ccgccgagct cgggcagtgg cgaatggctc gcggcttctt cgccgattac      2760
     aagaaccccc cgaacgcggc gcgaggcgcg ggtctgaaac ccgtcgaggc ggccatcgcg      2820
     gtgaacacca ggagcggcgg gtggacgtgc ccgtgcccca gcgaggagta cgtcatgaac      2880
     aggctgctca atgacgagat gttcccggag gagaaacagt tcagcggggg aaagattgcc      2940
     atgttagtga cgcaggagga gaaggccagg gaagaggaga aggcgcagtt gacggcgaag      3000
     ggcggggacg cggtggcggg gatgggcggg ccgcgtaggc ccgccgcgca ggccggggtt      3060
     gggaccgctt cgtcgttttc gcttcgtcgc ggcttggggt tgctcgaaga cggactcaac      3120
     gcggcggcgc tcggggcgga ggctatcgag tctgacgtcc cggggaagca gttcatcgac      3180
     gcgtcaccgg acgggacgga cgggtcgtgc gcgcgctcgg aggatgggac cccgtcgggg      3240
     ttcgccgagc tgcccagcat gggtctcata tcctggaggt tcaactaa                   3288
//

If you have problems or comments...

PBIL Back to PBIL home page