(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE500

MICSR_1.PE500        Location/Qualifiers
FT   CDS_pept        join(complement(1001733..1001810),
FT                   complement(1000743..1001606))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637418"
FT                   /orf_name="MICPUN_57086"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62266.1"
FT                   /db_xref="UniParc:UPI000199A65E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E227"
FT                   /transl_table=1
FT                   /translation="MEPASPIPPWVEKPEECRWFYGDERPLPAKLWSLQNMWYEGEIGP
FT                   DTLVWTEGMGRRTRVRDMPTLLGILRGDEDEPTGLDQLLADAADADHERVADGATTSFG
FT                   DEALLDAELGSGSSSWELNGGRQRAAAAAAAAGRSSPALVLTLLRELQATQERCAKHEA
FT                   REMALAREEAQARELVRELRALAVEAREARRGLASSPFDLARLAGDASFGDAGTVASLL
FT                   AANDAMDGGECAWAGGSEGAPEEAAVRGRASRRRPAAKADGDSSSAAAAAAARRRRSGD
FT                   GRRASGPGVGTVTVVRLRRKKDAELPRPEWQT"
     atggagcccg cgtcgccgat tccgccatgg gtagaaaagc cagaggagtg caggtggttc        60
     tacggcgacg agcgaccgct cccagcgaag ctgtggtctc tccagaacat gtggtatgaa       120
     ggcgagatcg gcccggacac gctggtgtgg acggagggca tggggagacg aacgagagtc       180
     cgcgatatgc cgactctgct cggcatcctc cggggcgatg aggacgagcc cacgggtctc       240
     gaccagttgc tcgccgacgc ggccgacgca gaccacgaac gcgtcgccga cggcgcgact       300
     acgtccttcg gcgatgaagc gcttctcgac gccgaactgg gcagcggatc ctcttcctgg       360
     gagctgaacg ggggcagaca gagggcagca gccgcagccg cggcggcggg aagaagttcc       420
     ccggcgctgg tgctgaccct gttgagggag ctgcaggcga cgcaggaacg gtgcgcgaag       480
     cacgaggcgc gggagatggc gctggcgagg gaggaggcgc aggcgcgcga gctcgtcagg       540
     gagctgaggg cgttggccgt ggaggcgagg gaggcgaggc gaggtttggc gtcgtcgccg       600
     tttgacctcg cgcgactcgc gggggacgcc agctttgggg acgccgggac ggtcgcgagc       660
     ctcctagcgg cgaacgatgc gatggacggg ggtgagtgcg cgtgggctgg cggatccgag       720
     ggggcgccgg aggaggcggc ggtgcgtggg agggcgtcgc ggaggcgacc ggctgcgaaa       780
     gcggatgggg actcgtcatc cgcggcggcg gcggcggcgg cgaggaggag gaggtccggc       840
     gatggaaggc gcgcctcggg gcctggggtg ggcacggtca cggtcgtgcg gttgaggaga       900
     aagaaggatg cggagctccc gaggccggag tggcagacct ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page