(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE501

MICSR_1.PE501        Location/Qualifiers
FT   CDS_pept        join(complement(1004267..1004336),
FT                   complement(1001887..1004147))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637419"
FT                   /orf_name="MICPUN_57087"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62267.1"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013111"
FT                   /db_xref="UniParc:UPI000199A65F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E228"
FT                   /transl_table=1
FT                   /translation="MKRPGLLAIALALVVGVQSVRSEAPPPPCSGHGTLNPDSTCSCEN
FT                   PRPAAGATGWTGGLCQVPVVGLATQTIGTNEAQSDSLESATWKCYHMATPAATDWNYLS
FT                   LELKQLDGDPDVYGMLYNATDDGRYPTGNTQGWDFREVSSSARGSVRLTVGKRDWAHPN
FT                   DAAEGVYICVTAYGDRVASYELRSVFTRCPAAFAIDSETGATVATQCSAPATGGTTNPT
FT                   DVPGACDEASGTCACKAYADHAYVAPEGSEHDDVPPELGFDSCSARIDFVPSASKSESW
FT                   DDVTLAADAWTFYRFEITDDDYQIQVTMERDEDEGGTARLFLRHETLPDSRWGHHDLPD
FT                   DFVSGTRPTQEVLVTRGDVAFVAGTWYAGVHAGADASSKFTLTVQRFDCPRDCSGRGEC
FT                   VHEQNGTRTCACDTGPLGPYLGPGCEDEYSGLTPSADGWHVNGTLGASDYDFFALPDID
FT                   IRESKRQIELVLSARYDRDETSYYWRPERPVLLLNHGDRSAFPSADNYTFKVTMEERSK
FT                   EYSIQLCAAQMRGSKWQAALYNPARTIPMVYSMSFRKKGVCPSATDGECSDNGDCVADV
FT                   TSPDFATCRCKTGWAGADCNFRACPEGSFIAVPGEGHGTCYRECVDGKHRPDGCDRVAC
FT                   DPPARSAADGSGCVMDECSNDLFFVDSGSDVSCVKRCVASSAGSPKRLSEECDPDTVRG
FT                   AGGSSGSRRRLGFPGVMVLIVVALSVIAGGVGYYAYSSCGGAEALGTLRGALAWGNGRG
FT                   FRRYDRFEGERFDDFAAADFDTP"
     atgaagcgac cggggttgtt ggccatcgcg ttggccctcg tcgtcggggt ccaatccgtg        60
     cggtcggaag ccccaccgcc tccgtgctct ggtcacggta ccctgaaccc cgactccacg       120
     tgttcgtgcg agaatccacg ccccgccgcg ggcgcgaccg ggtggaccgg cgggctgtgc       180
     caggttccgg tggtcggcct cgccacgcag accatcggca cgaacgaagc gcagagcgac       240
     agcctcgagt ccgccacttg gaagtgctac cacatggcca cccccgcggc gaccgactgg       300
     aactacctct cgctcgagct caagcagctc gacggggacc ccgacgtcta cggcatgctc       360
     tacaacgcga ccgacgacgg tcgatacccg accggcaaca cgcagggatg ggactttcga       420
     gaggtgtcga gctcggcgcg gggctcggtg cgactgacgg tgggaaagcg ggactgggcg       480
     catccgaacg acgccgccga gggcgtctac atctgcgtca ccgcttacgg cgaccgcgtc       540
     gcgtcctacg agctccggtc ggtgttcacg aggtgtcccg cggcgtttgc gatcgactcc       600
     gaaacgggag ccaccgtcgc gacgcagtgc tcggcgccgg cgacgggggg aacgacgaat       660
     ccgaccgacg ttcccggagc gtgcgacgag gcgtcgggga cgtgcgcgtg taaagcgtac       720
     gcggaccacg cgtacgtggc gccggagggg agcgagcacg acgacgtgcc ccccgagctc       780
     ggctttgact cgtgctctgc tcggatagat ttcgtcccga gcgcctcgaa gagcgagtcg       840
     tgggacgacg tgacgctcgc cgcggacgcg tggaccttct accggttcga gatcaccgac       900
     gacgactatc aaatccaggt gacgatggag cgggacgagg acgagggcgg gaccgcgcgg       960
     ctcttcctga ggcacgagac cctccccgac tctcgatggg gccatcacga cctcccggac      1020
     gacttcgtct ccggcacgcg cccgacgcag gaggtgctcg tgacgcgcgg ggacgtcgcg      1080
     ttcgtggcgg ggacgtggta cgcgggcgtt cacgcgggcg ccgacgcctc ctccaagttc      1140
     accctcaccg tacagaggtt cgactgccct cgggactgca gcggtcgcgg cgagtgcgtc      1200
     cacgagcaga acgggacgcg aacgtgcgcg tgcgacaccg gaccgctcgg gccgtatctg      1260
     ggcccgggat gcgaggatga gtactcgggg ctcacgccga gtgcggacgg gtggcacgtc      1320
     aacgggacgt tgggcgcctc cgactacgac ttcttcgcgc tgccggatat cgacatccgg      1380
     gagagcaaga ggcagatcga gctcgtgctc agcgctcggt acgatcgcga cgagacgagc      1440
     tactactggc gaccggagcg acccgtgctg ctgctaaacc acggcgatcg atccgcgttc      1500
     ccgtccgcag acaactacac gttcaaggtg acgatggagg agcggtccaa ggaatactcc      1560
     atccagctat gcgcggcaca gatgaggggc tccaagtggc aagccgcgct gtacaacccg      1620
     gcgaggacga ttcccatggt gtactcgatg agcttccgca agaagggagt gtgcccttcg      1680
     gcgacggacg gtgagtgctc cgacaacggc gattgcgtcg ccgacgtgac gtcgccagac      1740
     tttgcgactt gccgatgcaa aacggggtgg gccggcgcgg actgcaactt cagggcttgc      1800
     ccggaaggat cgtttatcgc ggttccaggg gagggacacg ggacgtgtta ccgcgagtgc      1860
     gtggacggta agcatcgccc tgacgggtgt gaccgcgtgg cgtgcgaccc cccggcgagg      1920
     tcagccgcgg acggctcggg atgcgtaatg gacgagtgct ccaacgacct gttcttcgtc      1980
     gactcgggaa gcgacgtgag ctgcgtgaag cggtgcgtcg catccagcgc gggatctccc      2040
     aagagactga gcgaggagtg cgacccggac accgttcgcg gcgcgggcgg gtcctctggc      2100
     tcacgaaggc gcctcgggtt cccgggggtg atggtgctga tcgtcgtcgc gctgtcggtc      2160
     atcgccggcg gcgtggggta ctatgcgtat tcgtcgtgcg ggggcgctga ggcgttgggc      2220
     actttgaggg gcgcgctcgc gtggggaaac ggacgaggtt tcaggcggta cgacaggttc      2280
     gaaggggagc gatttgatga ctttgccgcc gcagattttg acaccccatg a               2331
//

If you have problems or comments...

PBIL Back to PBIL home page