(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE503

MICSR_1.PE503        Location/Qualifiers
FT   CDS_pept        1007244..1007687
FT                   /codon_start=1
FT                   /gene_family="HOG000012755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637421"
FT                   /orf_name="MICPUN_57089"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ACO61848.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG609650"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="UniParc:UPI000199A661"
FT                   /db_xref="UniProtKB/TrEMBL:C1E230"
FT                   /transl_table=1
FT                   /translation="MLATRVAPSAVFLRGAAVKSSARPVRVAGRGPVTTQAFFGGFGGG
FT                   VPKANGQPMICIDCGYIYRGDFDALPRDYKCPQCNVGKNRFKVVEQAGSSYANLAAQKK
FT                   ANKAAAAKAKKGKGPSPRELAKQKLLEAQEEKDRKKGGGFFGR"
     atgctcgcta cacgtgtcgc tcccagcgcc gttttcctgc gaggggcagc cgtgaagtcc        60
     tccgctcgcc ccgtgcgcgt tgccggtcgc ggaccagtca ccacccaggc atttttcggt       120
     ggcttcggcg gcggcgtccc caaggcgaac ggtcagccca tgatttgcat cgactgcggc       180
     tacatctatc gtggagactt cgacgcactc cccagggact acaagtgccc ccagtgcaat       240
     gttgggaaga accgcttcaa ggtggtggag caggcgggat cctcgtacgc caacctcgcc       300
     gcgcagaaga aggcgaacaa ggctgccgct gccaaagcca agaagggcaa gggccccagc       360
     ccccgcgagt tggccaagca gaagttgctc gaggctcagg aagagaagga caggaagaag       420
     ggcggtggat tcttcggccg ttga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page