(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE504

MICSR_1.PE504        Location/Qualifiers
FT   CDS_pept        join(complement(1009287..1009351),
FT                   complement(1007773..1009015))
FT                   /codon_start=1
FT                   /gene_family="HOG000229290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637422"
FT                   /orf_name="MICPUN_90282"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62268.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI000199A662"
FT                   /db_xref="UniProtKB/TrEMBL:C1E231"
FT                   /transl_table=1
FT                   /translation="MSSSLRRLATTVARAAAPVYQGTSRAAGWRQTTPALWRTARAYDV
FT                   NSRSKEHLNIGTIGHVDHGKTTLTAAITKVLAEIGGAEVVAFDQIDKAPEEKARGITIS
FT                   TSHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHILLA
FT                   RQVGVPNLAVFLNKVDMVDDEELIDLVEMELREMLSFYKFDGDNIPIVRGSALHALKGT
FT                   DDKLGKEAILELMKACDAFPSPERVLDKPFSMPVEDVFSIQGRGTVATGRIEQGIVKAG
FT                   EDVELIGIVPTQKTTVTGVEMFKKSLTQGQAGDNCGLLLRGLKRDQVQRGQVLCKPGSI
FT                   TPHKKFEAEIYVLNKDEGGRHTPFFSNYRPQFFMRTADITGTITLPEGTEMVMPGDNIT
FT                   AVFELITPIALEKGLRFALREGGRTVGAGIVSKVLD"
     atgtcttcct ctctccgcag gctcgcgact acggtcgcac gcgccgccgc cccggtgtac        60
     caaggtacgt ctagggctgc cggctggcgc cagaccaccc ctgcgctgtg gcgcaccgcg       120
     cgcgcgtacg acgtgaactc ccgcagcaag gagcacctca acatcggtac cattggccac       180
     gttgaccacg gtaagaccac cctcaccgcc gccatcacca aggttctcgc cgagataggc       240
     ggcgcggagg tcgttgcgtt cgatcagatc gacaaggctc ccgaggagaa ggctcgcggc       300
     atcacaatct ccacctcgca cgtcgagtac gagaccgata agcgtcacta cgcccacgtc       360
     gactgccccg gccacgcgga ttacgtcaag aacatgatca ccggcgccgc acagatggac       420
     ggcggcatcc tggtggtgtc cgcggcggat ggcccaatgc cgcagacgcg cgagcacatc       480
     ctcctagcgc gccaggtcgg cgttcccaac ctggcggtct tcctgaacaa ggttgacatg       540
     gtggacgacg aggagctgat cgatctggtg gagatggaac tgagggagat gctctccttc       600
     tacaagttcg acggcgacaa catccccatc gtccgcggct ccgcgctgca cgcgctgaag       660
     ggcaccgacg acaagctggg caaggaggcc atcctcgagc tgatgaaggc gtgcgacgcg       720
     ttcccttccc ccgaacgcgt gctcgacaag ccgttctcga tgcctgtgga ggacgtgttc       780
     tccatccagg gtcgcggtac cgtggcgacc ggccgcattg agcagggtat cgtgaaggcg       840
     ggcgaggacg tggagctcat tggcatcgtg ccgacgcaga agacgacggt gacgggcgtg       900
     gagatgttca agaagtccct cacccagggt caggcaggcg ataactgcgg gcttctgctg       960
     cgcggcctga agcgcgacca ggtgcagcgc ggccaggtgc tctgcaagcc cggctccatc      1020
     accccgcata agaagtttga ggctgagatt tacgtcctca acaaggacga aggcggccgt      1080
     cacaccccat tcttcagcaa ctaccgcccc cagttcttca tgcgcaccgc cgatatcacc      1140
     ggcaccatca ccctccccga gggcaccgag atggtcatgc ccggtgacaa catcaccgcc      1200
     gtgtttgagc tcatcacccc catcgccctg gagaagggcc tgcgcttcgc gctccgcgag      1260
     ggtggccgca cggttggcgc aggaatcgtg tcgaaggttc tcgattga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page