(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE505

MICSR_1.PE505        Location/Qualifiers
FT   CDS_pept        join(1009931..1009987,1010087..1010779)
FT                   /codon_start=1
FT                   /gene_family="HOG000264981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637423"
FT                   /orf_name="MICPUN_93725"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61849.1"
FT                   /db_xref="HOGENOM:HBG560258"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="UniParc:UPI000199A663"
FT                   /db_xref="UniProtKB/TrEMBL:C1E232"
FT                   /transl_table=1
FT                   /translation="MSQLESYATQTNVQKLSEEEKHKLVAEVMRYMLFSQYRDGAPVTR
FT                   TKLSEHLSKIAPELKRAKVSSYIVAEAQVKFNEIFGIEMKELSRKAQKKTGAARTNLQA
FT                   SEPTKEYVLKSLLPSKIRRQFIDREEDHTFRGFVMAVVALVSVSGGEIEEQVLWKHLAR
FT                   LGVRHDDEAHPKLGNVRDTLNKLCLQRYLMKEKGVGSDGKDTFRYSLAERAMDELPTEK
FT                   VDKYVTELMRGHNDEDGNAAGENGNTT"
     atgtcgcagc ttgagtcgta cgcgacgcag accaacgttc agaagctctc cgaggaggag        60
     aaacacaagc tcgtcgccga agtaatgcgg tacatgctct tctcgcagta ccgcgacggc       120
     gctccggtga ccaggaccaa gctctcggag cacctctcca agattgcgcc cgagctgaag       180
     cgcgccaagg tttcgtctta catcgtcgcc gaggcgcagg tcaagtttaa cgagatcttc       240
     ggcatcgaga tgaaggaact gtcgcgaaag gcgcagaaga agaccggggc ggcgaggact       300
     aatctgcagg cgtcggaacc caccaaggag tacgtgctca aatccttgtt gccgtcgaag       360
     attcgcaggc agttcatcga ccgggaggag gatcacacgt tccgcgggtt tgtcatggca       420
     gttgtcgcac tcgtctccgt cagcggcggc gagatcgagg agcaggtcct gtggaagcac       480
     ctggcgagac ttggggtgag gcacgacgac gaagcacatc ccaagctggg caacgtgagg       540
     gacacgctca acaagttgtg cttgcagagg tacctgatga aggagaaggg tgtgggcagc       600
     gacggcaagg atacgttcag gtattcactc gcggagcgcg ccatggacga gctgccgaca       660
     gagaaggtgg acaagtacgt gacggaactg atgcgggggc acaatgacga ggacgggaac       720
     gcagcgggag agaacggcaa caccacgtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page