(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE506

MICSR_1.PE506        Location/Qualifiers
FT   CDS_pept        1011884..1012333
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637424"
FT                   /orf_name="MICPUN_57093"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61850.1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199A6D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E233"
FT                   /transl_table=1
FT                   /translation="MSSSDVKHLADPSSPGAGRFTFVIKGKPEPWTKFRKRASGEKDVP
FT                   EPENEAYVAYEIRFFIDPYELEPPKRKANTVGVERSNGTMMLWHTYVPESQRGKGIAEI
FT                   IVEEAMEWASANSLSVDSSCSYVNETFMKRPHNRQRWKHIMIRDY"
     atgtcttcgt cggacgtgaa gcacctggcg gatccgagta gtcccggggc cgggcgcttc        60
     acattcgtga tcaagggaaa accagagcca tggactaagt tcaggaagcg cgcgagcggg       120
     gagaaggacg tgccggagcc tgagaacgag gcgtacgtcg cctacgagat acggttcttc       180
     atcgatccct acgagctcga gccaccgaag cgcaaggcga acaccgtcgg cgtggagcgc       240
     tctaacggga cgatgatgtt gtggcacacg tacgtaccgg aatcgcagag gggtaaggga       300
     atagcggaga taatcgtgga ggaggcgatg gagtgggcgt ccgcgaacag cctcagcgtc       360
     gactcttcgt gctcgtacgt caacgaaacc ttcatgaaga ggccgcacaa cagacaaagg       420
     tggaagcaca taatgatccg ggactattag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page