(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE51

MICSR_1.PE51         Location/Qualifiers
FT   CDS_pept        103342..105057
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636056"
FT                   /orf_name="MICPUN_56624"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61609.1"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000199ABAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S8"
FT                   /transl_table=1
FT                   /translation="MACAVLHPPSPVAEMFGRRPAEPSAGLPFSQATLDRLATAAADLR
FT                   RFLARVHFAHETVPGMMPGALYHPTEVFDLAKARYEHVWMPLLASENSASPRKLAAPLD
FT                   VQWMHHLHRLDPDAYRVDCERAFGRLVDPADPFLVAGDGAPSDDQAAESFARDAWNAIA
FT                   PEWPFDLEAALVDHRRRGGRLPPRGSSSAISFDSSSCDMIGSATRQGGFLWQVLPSETY
FT                   GDEDFIHRAARRYAMLVILWRDFPGEFLVPTYDQDLVWHAHLSVPSVYEKEMRTATYRN
FT                   AIGHDDSVNDRTPGAKLEVRGRRTMELWRTHYPVSTWDEPYARRGAMWRGDAPDWYWTC
FT                   QFPRPIPPSRAPGPVTEGSTFNQRIPAVELAPNVFYAPPSRIYDYTSRGNEKSGWICTF
FT                   EELVPPPFERAVDPGVQYVKVKVRYAGTTELVEGAWLRFQVPIGIFPPEFIADVDDASF
FT                   ITTCSFPVPHCEKYLHATFVTPVDIRHVIAQYQNRGCCVFCCGGGQQKNDYGLGPARQP
FT                   TTSSYGGGCGAACGSGGGGVGGACGGSYGGGGCGGGGCGGGGGGCGGGGGCGGG"
     atggcctgcg ccgtcctcca tcccccctcg cccgtcgccg aaatgttcgg caggagaccc        60
     gccgagccga gcgcggggct gccattttca caggccactt tggaccgtct ggcgactgcc       120
     gcggcggacc tgcgacgctt cctcgcgcgg gttcacttcg cgcacgaaac cgtcccgggt       180
     atgatgcccg gcgcactcta ccaccccacg gaggtgttcg acctcgcgaa agcgcggtac       240
     gaacacgttt ggatgcccct gctcgcctcg gagaactccg catcccccag gaagctcgcg       300
     gcgcccctgg acgtccagtg gatgcaccac ctgcaccgcc tcgaccccga cgcgtaccga       360
     gtcgactgcg agcgcgcgtt cggtcgcctc gtcgaccccg cggatccgtt cctcgtcgcg       420
     ggcgacggcg ccccttcgga cgaccaggcg gcggaatcgt tcgctcggga cgcgtggaac       480
     gcgattgcgc ccgagtggcc cttcgacctc gaggcggcgc tcgtcgatca ccgccgccgc       540
     ggcgggcgtc tcccaccacg cgggtcctcg agtgcgatct cgttcgattc gtcgtcgtgc       600
     gatatgatcg gcagcgcgac tcggcagggg ggtttcctgt ggcaggtact cccgtctgag       660
     acttacggcg acgaggattt cattcatcgc gcggcgaggc ggtacgccat gctcgtcatc       720
     ctttggcggg acttccccgg ggagtttctg gtgccgacgt acgatcagga cctggtgtgg       780
     cacgcgcact tgtcggtgcc gagtgtctac gagaaggaaa tgcgaaccgc cacgtaccgg       840
     aacgcgatcg gccacgacga ctccgtcaac gacaggacgc cgggcgcaaa gctcgaagtg       900
     cgaggacggc ggacgatgga gctgtggagg acgcattacc ctgtcagcac gtgggacgaa       960
     ccgtacgccc gaaggggggc gatgtggcgg ggcgacgctc ctgactggta ctggacgtgc      1020
     cagtttccga ggccgattcc gccttcgcgc gcgcccgggc ccgtgacgga gggcagcacc      1080
     ttcaaccaga gaatccccgc cgtcgagctc gccccaaacg tcttctacgc tcccccgtcc      1140
     agaatctacg attacacctc gaggggaaac gaaaagtcgg gctggatatg caccttcgag      1200
     gagctagtgc cgccgccttt cgaacgagct gtcgacccgg gcgtgcagta cgtcaaggta      1260
     aaagtgcggt acgcagggac gaccgaactc gtcgagggag cttggcttcg ctttcaggtt      1320
     ccgattggga tatttccgcc cgagttcatc gcggatgttg atgacgctag cttcatcacc      1380
     acttgttcct tcccggtacc acattgcgag aagtacttgc acgcgacgtt tgtcacgccg      1440
     gtggacatcc gccacgtcat cgcacagtat cagaaccggg gttgctgcgt cttttgttgc      1500
     ggcggtggtc aacagaagaa tgactacggg ctcggccccg cgcgacagcc gacgacgagt      1560
     tcttacggcg gcgggtgcgg cgcagcctgt ggaagcggcg gaggcggcgt cggcggagcc      1620
     tgtggaggca gctacggcgg aggaggctgc ggcggaggag gctgtggagg cggcggaggc      1680
     ggctgcggcg gaggaggagg ctgcggcgga ggatag                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page