(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE53

MICSR_1.PE53         Location/Qualifiers
FT   CDS_pept        complement(107042..107296)
FT                   /codon_start=1
FT                   /gene_family="HOG000238827" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636058"
FT                   /orf_name="MICPUN_56626"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62056.1"
FT                   /db_xref="HOGENOM:HBG560273"
FT                   /db_xref="UniParc:UPI000199ABAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T0"
FT                   /transl_table=1
FT                   /translation="MSQFLRQLGALKVKEVPKFLQDKVTVANVTSHTQKFIAEYKTKYI
FT                   DAGSPMPIYHVMCGVFVTAYITVWPTEYRHMMAAKHGHH"
     atgtcccagt ttttgcgcca gctcggcgcc cttaaggtga aggaggtccc caagttcctc        60
     caggacaagg tcaccgtcgc caacgtcacc tcccacaccc agaagttcat cgccgagtac       120
     aagaccaagt acatcgacgc gggatccccg atgcccatct accacgtcat gtgcggcgtg       180
     ttcgtgaccg cctacatcac cgtgtggccc accgagtacc gccacatgat ggccgccaag       240
     cacgggcacc actga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page