(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE54

MICSR_1.PE54         Location/Qualifiers
FT   CDS_pept        complement(107502..108644)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636059"
FT                   /orf_name="MICPUN_107857"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62057.1"
FT                   /db_xref="UniParc:UPI000199ABB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T1"
FT                   /transl_table=1
FT                   /translation="MISATIATCRAAPATSVPRSRAAARAVPSAMRPAPTAISRSRVAA
FT                   RSAPAFREARRVRGAALLARASKGDRVSIGDMKKALVAAGVDTSSCFERADLEAKYALL
FT                   TDDQKAMKGGGSSGASAGSGSGASSSSTQQQEQQRASSSSSSSSSSSSSSSTSSSSSSS
FT                   SSSSETKKDSGSGFDPSKVFQSVLNTIRETANRVDVKWGVGAKLREQTKGFRDAIVNLD
FT                   EKLGATAFVKRVAPPAWAEVQKFRATPLGRIANSVFFIWLFFSGFFWTLVTLGITGVFL
FT                   TNLLFPNFFAERAQKMQAEAQARFREQQAAGMGGMGGNPYGGMGGMGGMGGMGGNPYGG
FT                   MGGMGGMGGGGGTGGGSSSAGRKSYGSGDVFDVDADVKDA"
     atgatctcag ccacgatcgc gacgtgccgc gcggcgccgg cgacctcggt accgcgatcc        60
     cgagccgccg cccgcgcggt cccctcggcg atgcgccccg cgccgacggc aatctccaga       120
     tctcgagtcg ccgcgcgatc ggcgcccgcg ttcagggagg cgcgtcgcgt ccgcggcgcc       180
     gcactcctcg cgcgcgcgtc caagggcgac agggtatcca tcggtgacat gaagaaggcc       240
     ctcgtggccg cgggcgtgga caccagctcg tgcttcgagc gagccgatct cgaggccaag       300
     tacgccctcc tcaccgacga tcagaaggcc atgaagggag gaggctcatc aggggcgtcg       360
     gcgggctccg gctccggggc atcgtcctca tcgacccagc agcaggagca gcagcgagcg       420
     tcgtcgtcct cctcctcctc ctcttcatca tcatcgtctt catccacctc ctcctcctcc       480
     tcctcctcct cctcgtcctc ggagacgaag aaggactcgg gctcgggctt cgacccgagc       540
     aaggtgttcc agtccgtcct caacaccatc cgcgagaccg caaacagggt cgacgtcaag       600
     tggggcgtcg gcgccaagct cagggaacag acgaaggggt tcagagacgc aatcgtgaac       660
     ctcgacgaga agctcggcgc caccgcgttc gtcaagagag tcgcgccgcc cgcgtgggcg       720
     gaggtgcaaa agttccgcgc cacgccgctg ggcaggatcg caaactccgt cttcttcatc       780
     tggctcttct tctccgggtt cttctggacc cttgtcacgc tcggaatcac cggcgtgttc       840
     ctcaccaatc tgctctttcc caactttttc gccgagaggg cgcagaagat gcaagccgag       900
     gcgcaggcgc ggttccgcga gcagcaggcc gccggcatgg gcggcatggg cggtaacccc       960
     tacggaggca tgggcggcat gggaggcatg ggaggcatgg ggggtaaccc ctacggcggc      1020
     atgggaggca tgggaggcat gggaggcggc ggcggcacgg gcggaggttc gagctccgcc      1080
     ggccggaaga gctacgggtc cggggacgtg ttcgacgtcg acgccgacgt caaggacgcg      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page