(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE55

MICSR_1.PE55         Location/Qualifiers
FT   CDS_pept        108818..109318
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636060"
FT                   /orf_name="MICPUN_56628"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61610.1"
FT                   /db_xref="UniParc:UPI000199ABB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T2"
FT                   /transl_table=1
FT                   /translation="MSRAFIVASTSSGLVAPGRAPRTRHSGPNPVALKPIGRSPAYAPS
FT                   LKKKEDDVGGSRNKPGIARLFGGGNSDMKAKVAQLEYELENERAHASELGGKLRAVEGE
FT                   LAKVKDSLDLYKGRCKEQEKEIFKLEKKNEETQRGFDTGMAVAKKQIKYLEELLEEEKR
FT                   KNQ"
     atgtctcgcg cgttcatcgt cgcgtccacg agctccgggc tcgtcgcgcc tgggcgcgcg        60
     ccccgcacgc gccacagcgg cccgaatccc gtcgccctca agcccatcgg caggtccccg       120
     gcgtacgccc cctccctgaa gaaaaaagaa gatgacgtcg gtgggtccag gaacaagcca       180
     ggcatcgcca ggctgttcgg cggtggcaac agcgacatga aggcgaaggt cgcgcagctg       240
     gagtacgagc tcgaaaacga gagggcgcac gcctcggagc tgggcggcaa gctccgggcc       300
     gttgagggcg agcttgccaa ggtcaaggac agtctggacc tgtacaaagg gcgatgcaag       360
     gagcaggaga aggagatatt caagctggag aagaagaacg aggagacgca gcggggtttc       420
     gacacgggca tggcagtcgc gaagaagcag attaagtact tggaggagct gctcgaggag       480
     gagaagagga agaaccagtg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page