(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE56

MICSR_1.PE56         Location/Qualifiers
FT   CDS_pept        complement(109375..109887)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636061"
FT                   /orf_name="MICPUN_56629"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62058.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199ABB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T3"
FT                   /transl_table=1
FT                   /translation="MEKTTIWRPNVRIDIEDVVADAEVADEVNDASLTKKGTKRKRAHV
FT                   GPCEHGVKYRSYCKVCSACSHGRRRSTCKECGGASICEHGRVRSQCKECGGSEICEHGR
FT                   RRSLCKECGGGSICEHGRQRSQCKECGGGSICEHGRRRSTCKECGGGSICEHGRRRFRC
FT                   KECGKEC"
     atggagaaga cgacgatttg gaggccaaac gtcaggatcg acatcgaaga cgtcgtcgcg        60
     gatgctgaag tcgcggatga ggtgaacgat gcgagtctga cgaagaaggg gacgaaacgg       120
     aagagagccc acgtcggccc gtgcgagcac ggggtgaagt atcgctcata ctgtaaggtg       180
     tgcagtgctt gctctcacgg tcgtcggcgc tctacgtgca aggagtgcgg tggtgcatca       240
     atctgcgagc acggtcgtgt gcgctctcag tgcaaggagt gcggcgggtc tgaaatctgc       300
     gagcacggtc gtcggcgctc tctgtgcaag gagtgcggcg ggggctcaat ctgcgagcac       360
     ggtcgtcagc gctctcagtg caaggagtgc ggcgggggct caatctgcga gcacggccgt       420
     cggcgctcta cgtgcaagga gtgcggtgga ggctcgatct gcgagcacgg ccgtcggcgc       480
     tttcggtgca aggagtgcgg caaagagtgt tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page