(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE58

MICSR_1.PE58         Location/Qualifiers
FT   CDS_pept        110227..110973
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636063"
FT                   /orf_name="MICPUN_79527"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61612.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000199ABB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T5"
FT                   /transl_table=1
FT                   /translation="MGVATVTPVIAAPRPTHRPGGRKSRVVRANALEIADVVRVASDGG
FT                   VVLAGYVASDLVAQASETRSAERSAEECRVDVDCEIPPTPQGLDVIRLNRYAAFGWFDG
FT                   CISHVFIGWLDAASSGWTSNEAARCFDQVVVDMALFSPVWCALFLISMEAMMMDTRLPL
FT                   RAAVSARLKGEYSELLLGNLGFWIPANAVVFGLVAVDYRVAAFSAINFAYTVLLSIWAE
FT                   GDKDKPQEAADKEKVETKEIETVDQI"
     atgggcgtgg cgactgtaac tccggtgatc gccgcgccgc gcccgacgca tcggcccggg        60
     gggcgtaaat cacgcgtcgt ccgcgccaac gctctcgaga tcgccgacgt ggtccgagtc       120
     gcgagcgacg gcggggtggt tttggcggga tacgtcgcga gcgacctcgt ggctcaggca       180
     tcggagaccc gaagcgcgga gcggagcgcg gaggagtgcc gcgtcgacgt cgattgcgag       240
     atacccccga ccccgcaggg gctggacgtc atacggctga accggtacgc ggcgttcgga       300
     tggttcgacg gatgcatctc tcacgtgttc atagggtggc tggacgcggc gagctcgggt       360
     tggacgagca acgaggcggc gcggtgtttc gatcaggtgg tcgtcgacat ggcgctgttc       420
     tccccggtgt ggtgcgcctt gttcctcata tcgatggagg cgatgatgat ggacaccaga       480
     ctgccgctga gggccgcggt gtcggcgagg ctcaaggggg agtacagcga actactgctc       540
     gggaacctgg ggttttggat ccccgcaaac gcggtggtgt tcgggctggt agccgtggac       600
     tacagggtgg ccgccttcag cgcgatcaat ttcgcgtaca ccgtgctgct gtccatatgg       660
     gcggaagggg ataaagataa accgcaggag gcggcggata aggagaaggt cgagacgaaa       720
     gagatcgaga ccgtagatca gatttag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page