(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE59

MICSR_1.PE59         Location/Qualifiers
FT   CDS_pept        join(complement(111131..112881),complement(111081..111096))
FT                   /codon_start=1
FT                   /gene_family="HOG000012638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636064"
FT                   /orf_name="MICPUN_56631"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62059.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199AC26"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T6"
FT                   /transl_table=1
FT                   /translation="MVAEDAPPAVETEESPAPAEGAPAADDPPPSPPVEAEETPAPNPD
FT                   DDAPAPSGDSRVDGGVVARGPRTESHHDAGAGAEDLVDCTFVVLPERFEHSATIPATEP
FT                   FASVKSMLASALPIPLDAVMTLRQPDGGEPLPDDACLADYGVGAADEVDLELVVAYRTE
FT                   REMRAEAEENARREAEDFARLEEQAAAAAAAEAAQLAEESRLANTDAPSSLPETLRVTV
FT                   RGARRGEPSRVVTVRIDASGCVKPRYLGGFRDRRDGTVYHHASNQTIPTKPRVWKTKFT
FT                   TETQTAQGRSRLAQTTAQASTQMARKDLVMDESRDVEVWTGKYMTYDEVMVIKARHTLT
FT                   LQKYFRGMRARRLANELRAIRDDAVRRAEEEEAARAAAEERRRRFEIERRIRPKTSEDF
FT                   ELLYDELEQWRVRETAKVEAEFPPETDARRLAMSQLLAKETELIRTIGRLRIAANNANR
FT                   ERRVERALEDMSQTKRWERKDGSLVEVDTPFTVRARELARLYDALRLETRRDVSTDERL
FT                   DVLVHVKWTVKEFDCGLTREIVELADREADLLNRGRDPAAMTGLRRRIANLFLQFVETP
FT                   EFNPESARRTTD"
     atggtcgcgg aagacgcccc gcccgcggtg gagacggagg agtcacccgc ccccgcggag        60
     ggtgctccag ccgcggatga tcccccgccg tccccgcccg tcgaggcgga ggaaaccccc       120
     gcccccaacc cggacgatga tgcccccgcc ccgtcggggg attcccgcgt cgacggaggc       180
     gtcgtcgcgc gaggaccccg gaccgagtcg caccacgacg ccggcgcggg cgccgaggac       240
     ctcgtcgact gcaccttcgt cgtcctcccc gagcgcttcg agcactccgc gacgatcccc       300
     gccaccgagc cgttcgcgtc ggtgaagtcc atgctcgcgt ccgcgcttcc aatcccactc       360
     gacgccgtga tgaccttgcg acagcccgac ggcggcgagc cgctcccgga cgacgcgtgc       420
     ctcgcggact acggcgtcgg tgccgcggac gaggtcgacc tggagctggt cgtggcgtac       480
     cggaccgagc gggagatgcg ggcggaggcg gaggagaacg ccaggcggga ggctgaagat       540
     ttcgctcgtt tagaggagca agccgcggcg gcggcggcgg cggaggcggc acagctggcg       600
     gaggagtcca gactcgcgaa cacggacgcg ccgagctcgc tgccggagac tctgcgggtc       660
     acggtgaggg gcgcacggcg aggcgaaccg tcgcgcgtgg tgacggttcg tatcgacgcg       720
     agcggttgcg tcaagccgcg atacctcggc ggttttcgcg atcggcgcga cggtaccgtg       780
     taccaccacg ccagcaacca gacgatcccg acgaaacccc gcgtgtggaa gaccaagttc       840
     accaccgaga cgcagacggc gcagggcagg tccaggctgg cgcagaccac agcgcaggcg       900
     tccacgcaga tggcgaggaa ggatctcgtc atggacgagt cgcgggacgt cgaggtttgg       960
     actgggaagt acatgacgta tgacgaggtc atggtcatca aggcgaggca caccctgacg      1020
     ctgcagaaat acttccgggg tatgcgggcg aggcggctgg cgaacgagct cagggccatt      1080
     cgcgacgacg ccgttcgccg cgcggaggag gaggaggcgg cgcgggcggc ggcggaggag      1140
     cgaaggagga ggttcgagat tgagcgccgg atcaggccca aaacctcgga agatttcgag      1200
     ctcctctacg acgagctgga gcagtggcgc gtgcgggaga cggccaaggt ggaggctgag      1260
     tttccccccg agacggacgc gcggcgcctg gcgatgagcc agctgctcgc caaggagacg      1320
     gagctcatcc gaaccatcgg caggctccga atagccgcca acaacgccaa cagggaacgg      1380
     agggtggagc gcgcgctcga ggacatgtcg cagacgaagc ggtgggagcg caaggacggc      1440
     tcgctcgtcg aggtggacac gccgttcacg gtgcgggcca gggaactggc tcgtctatac      1500
     gacgcgctgc ggctggagac gaggcgcgac gtgtcgacgg atgagcgcct ggacgtgttg      1560
     gtgcacgtca agtggacggt gaaggaattc gactgcgggt taactcgcga gatcgtggag      1620
     ctggcggacc gcgaggcgga tctgctgaac cgcgggcgcg atccggcggc gatgacgggg      1680
     cttcgcaggc gcatcgcgaa tctgtttttg cagtttgtcg agacgccgga gtttaacccg      1740
     gagagcgcga gacggacgac ggactga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page