(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE6

MICSR_1.PE6          Location/Qualifiers
FT   CDS_pept        complement(16396..17931)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636011"
FT                   /orf_name="MICPUN_99223"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62032.1"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniParc:UPI000199AA4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N3"
FT                   /transl_table=1
FT                   /translation="MVMVSQPTHPAFYEDDVRYHKCNVCAAEFNIPPPTRHELMQSFTG
FT                   AEIAALISEGCVIGSHRVFSDELERQMETMHPIQRLMTGYPHWIKGVYLIVDVREDNGR
FT                   ISLPVRTDASLDRVRQRFQAEAERSGYDGISLEVGGKKHTILAGVGSFKEVKDGDVEGI
FT                   KATLAALKAPAMLVLASETEPDCGEDSVTAVNMCRPVQLPPAAAQHLDALNERSNGADS
FT                   DLSTGIPDMMEWMEKFEDTEQFGSLDEAKNALRLEMHLAQYRATMDVMKKYPGVRRVKV
FT                   EHFIGGPCESDDIMWCVVPGGMKRGWTVVSRTLDSSEDESDESVKRAKSNVSTLVSAMM
FT                   LAHTRAVRRDDAQGDVCGGQTVRLRNLQARADLNGEVGLALRYDSESGRWMIRLRNGEG
FT                   KSVKPDNLEAMDGEGGRVFAFWGDARWSRAQLLGEIARGHWGLCRAGVGDITTSTAERW
FT                   ESLETSGRMAFAPVTEMTEDFMKNAHREMQVFRPSAAAAEGEDEGVQRDHSED"
     atggtgatgg tctcgcagcc gacccacccc gcgttctacg aggacgacgt gcgctatcac        60
     aagtgcaacg tttgcgccgc ggaattcaac attccccctc ccacaaggca cgagctcatg       120
     cagagcttca ccggcgcgga gatcgccgcg ctcatttcgg aagggtgcgt catcggttcc       180
     caccgggtgt tctctgacga gctcgagaga caaatggaga ccatgcaccc gatacagcgg       240
     ttgatgacgg gttacccgca ctggatcaag ggcgtgtatc tcatcgtgga cgtgagagag       300
     gacaacgggc ggatatcgct ccctgtgcgc accgacgcca gcctcgaccg ggtccgccag       360
     aggttccagg cggaggcgga gcgttcggga tacgacggca tctctcttga ggttggaggc       420
     aagaagcaca cgatattggc gggtgtgggc tcattcaaag aggtcaagga tggggacgtc       480
     gaaggtataa aggcgacgct agcggcgctc aaggctcctg cgatgttggt gctcgcgtcc       540
     gagacagagc cagactgcgg cgaggattca gtgacggcgg tgaacatgtg cagacccgtg       600
     caactcccac ccgcggctgc gcaacacttg gacgctctga acgagaggag caacggcgca       660
     gactctgacc tgtctacagg gatccctgac atgatggagt ggatggagaa gttcgaggac       720
     accgagcagt ttggctcgtt ggatgaggcg aagaacgcgt tgaggcttga aatgcacctg       780
     gctcagtaca gggcaacgat ggatgttatg aaaaaatacc cgggcgtccg gcgcgtcaag       840
     gttgagcatt tcatcggtgg cccgtgtgag agcgacgata tcatgtggtg cgtcgtgccc       900
     ggcgggatga agcgcggctg gacagtggtg agcaggacgt tggactcctc cgaggatgaa       960
     tctgatgaaa gcgtcaagag ggccaagtca aacgtgtcta cccttgtaag cgcgatgatg      1020
     ctcgctcaca ccagagccgt gcgacgtgat gacgcgcagg gagacgtatg cggtggtcag      1080
     acggtgcgtc tgcgaaacct gcaggcgagg gcggacttga acggagaagt tggactcgcg      1140
     ctccggtacg actctgagtc tggacgatgg atgatccggc taagaaacgg agaagggaag      1200
     agcgtcaagc cggataactt ggaggcgatg gatggagagg gtggccgtgt gtttgcgttc      1260
     tggggcgacg cgaggtggtc gagggcgcaa ctgctcggcg aaatagctcg cggacactgg      1320
     ggcctctgcc gtgcgggcgt cggcgacatc acgacgagca ccgcagaacg gtgggaatcg      1380
     ctggagacat caggtcgcat ggcgtttgcg cccgtgacag agatgacgga ggacttcatg      1440
     aaaaatgcgc acagagagat gcaggtgttt aggccgagtg cggcggctgc ggagggcgaa      1500
     gacgaggggg tccaacggga tcattcggag gattga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page