(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE60

MICSR_1.PE60         Location/Qualifiers
FT   CDS_pept        join(113184..113276,113369..113572,113683..113746,
FT                   113880..114520)
FT                   /codon_start=1
FT                   /gene_family="HOG000256146" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636065"
FT                   /orf_name="MICPUN_80273"
FT                   /product="Predicted protein"
FT                   /function="spermidine synthase activity"
FT                   /biological_process="spermidine biosynthetic process "
FT                   /protein_id="ACO61613.1"
FT                   /db_xref="GO:0004766"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG635113"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniParc:UPI000199AC27"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T7"
FT                   /transl_table=1
FT                   /translation="MAHTSGIGADVFDKGNWYHEVLEDGLAISYRVEEVLHKGQSKFQT
FT                   VEVVKTKPFGRLLITDGLMQSSEDDEYVYHQSLVHPALAGHPEPKKVFIAGGGEGATLR
FT                   EVLKHPSVEECKMVDIDGEVVDMCAKHTPFYNAGAYESPRAKLVIGDAKAGLEAEPDGS
FT                   IDVIICDLSDPLDGGPCYQLYTTSFYEMCKSKLAPGGILVTQSGCAAVRDCKAVFTPIN
FT                   KTLREVFPQVWGYTVCVPSFCSEWGFNIATKDADHVDLYTGITANGELDKRLAARGLGA
FT                   LSYYDGITHTRMFSLNRTVREACERETRVMTVENPLFMCSTDTHAGVFEPEK"
     atggctcaca ctagcggcat cggcgccgac gtcttcgaca agggcaactg gtaccacgag        60
     gtcctcgagg atggcctcgc catctcctac agggttgagg aggtgctcca caagggccag       120
     tccaagttcc agaccgtgga ggtggtcaaa accaagccct tcggccgtct gctcatcacc       180
     gacgggctca tgcagagctc cgaggatgac gagtacgtct accaccagtc cctcgtccac       240
     cccgcgctcg cggggcaccc ggaacccaag aaggtgttca tcgcgggcgg cggagagggc       300
     gccacccttc gcgaggtgct gaagcacccc agcgtcgagg agtgcaagat ggtcgacatc       360
     gacggcgagg ttgtcgacat gtgcgccaag cacaccccgt tctacaacgc gggcgcgtac       420
     gagtccccgc gggccaagct cgtcatcggc gacgccaaag ccgggctgga ggctgagcca       480
     gacggctcca tcgacgtcat aatctgcgat ctctccgacc cgctcgacgg cggaccgtgc       540
     taccagctgt acaccacctc gttctacgag atgtgcaagt ccaagctcgc gccggggggc       600
     atcctcgtga cccagtcggg gtgcgccgcc gttcgcgact gcaaggcggt tttcacccca       660
     atcaacaaga cgctcaggga ggtgttcccc caggtgtggg gctacaccgt gtgcgtgccc       720
     tccttctgct ccgagtgggg tttcaacatc gccacgaagg atgcggacca cgtggacctc       780
     tacaccggca tcaccgcgaa cggcgaactc gacaagcgac tcgcggcgcg gggcctcggc       840
     gccctctcct actacgacgg catcacccac acgaggatgt tctcgctgaa cagaaccgtg       900
     agggaggcgt gcgagcggga gactcgcgtg atgacggtgg agaacccgct gttcatgtgc       960
     tccacggaca cgcacgcggg cgtgttcgag ccggagaagt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page