(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE61

MICSR_1.PE61         Location/Qualifiers
FT   CDS_pept        115061..117271
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636066"
FT                   /orf_name="MICPUN_56633"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61614.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI000199AC28"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T8"
FT                   /transl_table=1
FT                   /translation="MADDEPPGDAVHTKGLWNRRRDLRCVRRHLGIGPDGDPDVEVRCA
FT                   RGDRVIAVGYRRVLLGDHGPYLELEREHVRWENLRLMPGGAARFYDEYRAIVDGESYDD
FT                   IAHSSIGTGGGGRGAKLYDQLKTVEGQGNPPRDSAWAVANNRPHEEGYAAYVVGKIYVG
FT                   AYDVAVRDPVVDADDVRRALPKPGGSGRVAWWKPARGVGAIVPDGVVGARNEGAGGGEE
FT                   EFATKEVSVTRDALAGGADTLAPGEGVWFDLESSGPSDRSVAVNVTGPGGEPVRQLCPG
FT                   AAAAAAEAARNGQKRSETARALRDGRRSAAALAAARARTVPWEARAEVERDAVAGAARR
FT                   IARILRDNCAAIAGLARIEGEGQRTLRACLRGWARWARKGSKSGEGDGSFGAGGVGRPS
FT                   TAPTLASPRRRDPPPGESPPPPRLNLTSAGRAKGLFAPVTRPPTPVASNPKTPRGPDEA
FT                   GDDPPAASVALPAWLTAVARGAVVCEVSHTRSSSAGDAAADAAGRVSKRCGFEARMPGL
FT                   EDSVRPVVVELTRDGVGALRTGAEGAEGADSGDRDPVAEAVARVDENLPVAEFGSSPLV
FT                   LVLPAGEEKASGSTVHPPRVPRLALRASKRVVGVVCVSSGPEQLVRDAVALAGACALGT
FT                   APFVPTEVFAAAGLDAAREWSRDDPRVASCVAVFERAGWGAARGMETGAGRDYCWRCGD
FT                   RSHRKRDCERVAGARPGENRPATTGGGGGRDVEAARVAELRL"
     atggccgacg acgaaccccc gggcgatgcc gtccacacca aaggcctgtg gaaccgccgc        60
     cgggacctgc gatgcgtccg gcgtcacctc gggatcggcc ccgacggcga ccccgacgtg       120
     gaggtccgat gcgcgagggg cgatcgagtc atcgcggtcg ggtaccgccg cgtgctcctc       180
     ggggaccacg ggccgtacct cgagctcgag cgcgagcacg ttcgatggga gaacctccgg       240
     ctgatgcccg gaggcgccgc gaggttctac gacgagtacc gcgccatcgt ggacggcgag       300
     agctacgacg acatcgcgca ctcgtccatc ggcacggggg gcggcggccg gggcgccaag       360
     ctctacgacc agctcaagac cgtggagggg caggggaacc cgccgaggga cagcgcgtgg       420
     gccgtggcca acaacaggcc acacgaggag ggctacgccg cgtacgtcgt cggcaagatc       480
     tacgtcggcg cgtacgacgt cgccgtcagg gatcccgtcg tcgacgccga cgacgtccga       540
     agagccctgc cgaagcccgg cgggtcgggc cgcgtggcgt ggtggaaacc ggcgcgaggc       600
     gtcggcgcca tcgtcccgga cggcgtcgtg ggcgcgagga acgagggcgc aggcggcggc       660
     gaggaggaat tcgcgacgaa ggaggtctcc gtgacccgcg acgccttggc ggggggagcc       720
     gatactctcg cgccggggga gggagtctgg ttcgatctcg agtcgtcggg accgtccgat       780
     cgctcggtcg cggtgaacgt caccgggccg gggggcgagc ccgtgcgaca gctgtgcccg       840
     ggcgcggcgg ccgccgcggc ggaggcggcc agaaacggcc agaaacggtc agagacggcc       900
     cgggcgctga gggacggtcg aaggtccgcg gcggcgctcg cggcggctcg agcgaggacg       960
     gtgccgtggg aggcccgggc ggaggtagag cgtgacgcgg tggcgggcgc ggcgaggagg      1020
     atcgcgagga tcctccggga taactgcgcc gccatcgcgg ggttggcgag gatcgagggc      1080
     gaggggcaga ggacgctgag ggcgtgcctc cgggggtggg cgagatgggc gaggaaaggg      1140
     tcgaaaagcg gcgagggaga cgggagcttc ggcgcgggcg gcgtcggtcg gccgtccacc      1200
     gcgcccaccc tcgcgtcgcc ccgacgccgc gacccgccgc ccggtgagtc accgcccccg      1260
     ccgcggctca acctcacctc cgcggggcgc gccaagggtt tattcgcgcc cgtcacgcgg      1320
     cccccgacgc ccgtcgcttc aaatccaaaa acgccccggg gacccgacga agcgggggac      1380
     gacccacccg ccgcgagcgt cgcgcttccc gcgtggctca ccgcggtggc gcgcggcgcg      1440
     gtcgtgtgcg aggtgtccca cacgcgttcg tcctccgcgg gagacgccgc ggccgacgcc      1500
     gccggtcggg tttcaaagcg gtgcggtttc gaagcgcgga tgcccggttt ggaagactcg      1560
     gttcgaccgg tcgtcgtgga gctcacgcgc gacggcgtcg gcgcgcttcg tacgggtgcc      1620
     gagggtgccg agggtgccga ctccggcgat cgcgatcccg tcgcggaggc ggtggcgcgc      1680
     gtcgacgaga acctcccggt ggcggagttt gggtcgtccc ccctggtgct ggtgctgcca      1740
     gcgggggaag aaaaagcctc gggttccacc gtccatcccc ctcgggtccc gaggctggcg      1800
     ctccgcgcgt cgaaacgggt ggtcggggtc gtgtgcgtct ccagcgggcc ggagcagctg      1860
     gtgcgggacg cggtggcgct cgcgggggcg tgcgcgctcg ggacggcgcc tttcgtcccc      1920
     accgaggtct tcgccgccgc cgggctcgac gccgctcgcg agtggtccag ggatgatccc      1980
     cgggtggcgt cgtgcgtggc ggtgttcgag cgggcggggt ggggcgcggc gcgagggatg      2040
     gagacgggcg cggggcggga ctactgctgg aggtgcgggg atcggtcgca caggaagagg      2100
     gactgcgagc gggtggcggg ggcgaggccg ggggagaatc ggccggcgac gacggggggc      2160
     gggggagggc gcgacgtgga ggctgcgcgg gtggccgagc tcaggctgtg a               2211
//

If you have problems or comments...

PBIL Back to PBIL home page