(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE62

MICSR_1.PE62         Location/Qualifiers
FT   CDS_pept        join(complement(117465..118370),complement(117377..117391))
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636067"
FT                   /orf_name="MICPUN_56634"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62060.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AC29"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T9"
FT                   /transl_table=1
FT                   /translation="MSSSLLRPSLLAIASRHAMSSPTKAALGRKHASPARRSFDVTVSA
FT                   AASQNVDKKYVPGEPIANACVVVTGANRGIGLEFCKQILAKSPGNSVIASCRDPNAADD
FT                   LVALQKEVGESRLAVVALDVADETSIASWAQGLGALEPVQAHGGSIDVVINNAGTTGTD
FT                   GYSKWELEDMTADEMMHVYKINTVGPLLVTQQLVKRGLIGDPGSLNPVSLVGNVTSKVG
FT                   SVDDNGSGKGYAYRASKAALNIVNKSMSIDLADRGIWCQLLHPGWVRTRMTEGRGLIDA
FT                   DESARGLIRCVMFRETRLFPLGYGG"
     atgtcgagct cgctcctccg tccgtccctc ctcgcgatcg cctcccgaca cgccatgtca        60
     tccccgacga aggctgcgct cgggcgcaaa cacgcctccc ccgcgaggag gagctttgac       120
     gtgaccgttt ccgcggccgc ctctcagaat gtggataaaa agtacgtccc cggcgagccg       180
     atcgcgaacg cctgcgtcgt cgtcaccggt gccaaccgcg gcatcggcct cgaattttgc       240
     aagcagatcc tcgccaagtc ccctggtaac tccgtcatcg cgtcttgtcg cgacccaaac       300
     gccgcggatg accttgtcgc gctccagaag gaggttggcg agtcgcgcct cgcggtggtc       360
     gccctggacg tcgccgacga gacctcgatc gcgagttggg cgcagggcct cggcgccctg       420
     gagcccgtcc aggcgcacgg cggatccatc gatgtcgtca tcaataacgc gggcaccacc       480
     ggcaccgacg gatacagcaa gtgggagctc gaggacatga ccgccgacga gatgatgcac       540
     gtgtacaaga taaacaccgt cggtccgctg ctggtcaccc agcagctcgt caagcgcggg       600
     ctcatcggcg accccgggtc cctcaacccc gtttcgctcg tcggaaacgt gacgtcgaaa       660
     gtcggcagcg tggacgataa cggcagcggg aaagggtacg cgtacagggc gagtaaagcc       720
     gcgctcaaca tcgtcaacaa gagcatgagc atcgacctcg cggatcgagg aatctggtgc       780
     caactcctgc atcccggttg ggtgcgaacg cggatgaccg aaggccgggg gctgattgac       840
     gcggacgaga gcgcccgcgg cctcatcagg tgcgtgatgt ttcgcgaaac acgtctcttt       900
     ccactcggct atggagggtg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page