(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE63

MICSR_1.PE63         Location/Qualifiers
FT   CDS_pept        118548..122960
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636068"
FT                   /orf_name="MICPUN_56635"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61615.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199AC2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U0"
FT                   /transl_table=1
FT                   /translation="MEASEELDHAGTAPGATGAKETAAGGGDSPMNENVGPGAMGTSTA
FT                   QTEAAAPGSGGKSAGTPDLPQSEPRSLTADDDDDERSGAAGVTADARDDDAGAELPPSR
FT                   SPDDAPVAPTTTTPAGPSSGDPARSLADVLGKRPTPASDPKSSASAKPPAKKAARAKPS
FT                   TGPGITSFFGGGGKGGSGSDEDAPSRMPTRAEKLAADEAEEAAAIAAALAASEADEEDR
FT                   RAKAAAAAAATEAPTAVPVATEAPTAVPAEGAAAATASPVQDHEPDPTAAVVSASEAKK
FT                   THPLLVAAQRKKEKAAAEARAKAEAEARAKAEAEAKAKAEAEARAKAEAEARAKAEAEA
FT                   KAKAEAEAAAVAKAEADARAKAEEEERRRAAEDAALLADGSCEICGVDDDDGLLCDGCD
FT                   GVFHAKCVDLDSTPANEWFCARCAEHGVTNAGGGVAQRRAAKRKKANDEKRRANPFFMT
FT                   PDERRVAAEREAKQALMRDLEAVKQTDAALSTGKKVHHFFAMQKEKAAAAKESGASAAS
FT                   LNPLGLYVLPAPIERAMPPVHITPPIDPTVAEDEAVGRNALASVAGPPRKITRDGRFNP
FT                   SPDATLDSIRRALSPPAAVDTEEEQEEEDPGGEEGVDLEEAEDAYLTDAARYVLASEGR
FT                   WNAGAIVSGELASARGELRARLASLRARGAARAAGRDGSSSTDGSRLDRSTPSIGPAAA
FT                   AGALWTDAYAPAATDQLVCDGGAARGVRDWLDAWSSRIFAEEAGVVVKPPKDKEKAGNG
FT                   GRKGKRRKKGRGNAAASDDDTSDEECDEWDDESSGSLGTYAPLVTKRGGLPANGLLLCG
FT                   PVGSGKTSAVYAAAEEFGFKVLEVNPSRKRSGLEVLSQFGEATQSRRIGGGGDEQKKQG
FT                   AGGIGGFFGKKPAPAATTTSAPAKDTAKKDTAKETARNTLILFEEVDVLRGEDRGFMAA
FT                   LAQLIAGAKRPIVLTSNSPSLPSLIDAPLPAGTSGDGLRLARVRFRSPSPADAAVYASL
FT                   VAAAEGKRVSPGEVASAARLADAGDVRRALLSAQFAASSPAAEMTRRPTRGTTKSRSTA
FT                   AVAALEYDTNAVAAVAAELIARVDPRVAAAEALAPARALYAMSLVAEASQIEERETERR
FT                   AEEAAVRRRAEVVAAAAAAKAERAARNDARIEKGPLGSVGGRGGDRRGSLGLVAAGRSA
FT                   ANGDDEDGEEAERAAKVAAAADAARDAYLAEAAARFAERAPGGESPGGDSPETPPDAYP
FT                   GDDWARALRELDSLASLSASLSAADAMLNPARATVTGPSNGAAERVDVGGWLGGAGAAW
FT                   GDGGDGGWFDPSDDAEERGGADLAGEPRHTIGGGGDVAREASARIERLAVDACLGDRLV
FT                   DCRPPPRGGVGGGPPPAATGPASSVPKPAVSYGRVPAMGAAAARLRELAECTGATCARG
FT                   YGCGLGATGEANERAFFLARIVRIQEESASGVGAEGGRRRRKKASQYLQVGADVARELA
FT                   ALGTFGVTA"
     atggaggcgt cggaggagct cgaccatgcg ggtacggctc cgggggcgac cggcgcgaag        60
     gagacggcgg cggggggcgg cgactccccg atgaatgaaa acgttggacc gggcgcgatg       120
     ggcacctcca cggctcagac ggaggcggct gctccgggca gcgggggcaa atcagcgggc       180
     acgccggacc ttccgcaatc ggagccgcga tcgctgaccg cggacgacga cgatgacgag       240
     cgctcggggg ccgccggggt gaccgcggat gcgagggatg acgacgcggg cgccgagctc       300
     cctccgtcgc ggtcgcccga tgacgccccc gtcgccccga cgacgacgac gcccgccggt       360
     ccatcgagcg gcgatcccgc cagatccctc gcggacgtcc tcggcaagcg acccaccccg       420
     gcatcggatc ccaagtcgtc ggcctcggcg aagccacccg cgaagaaggc tgcgcgagcc       480
     aagccgtcga cggggccggg catcacgtcg ttcttcggag gcggcggtaa gggcgggtcc       540
     ggttcggacg aggatgcacc ttcaaggatg ccgaccaggg ccgagaaact cgcggcggat       600
     gaggccgaag aggccgcggc catcgcggcg gcgctcgcgg cgtcagaggc tgacgaggag       660
     gaccggcgcg cgaaggcggc ggcggcggcg gcggcgacag aggcgccgac agctgtgccg       720
     gtggcgacag aggcgccgac agctgtgccg gcggaggggg cggcggcggc gacggcgtcc       780
     ccggttcagg accacgagcc cgatcccacg gccgcggtgg tgtccgcctc ggaggctaag       840
     aagacgcacc cgctgctggt cgcggcgcag cgcaagaagg agaaggccgc cgcggaggcg       900
     agggcgaaag ccgaggcgga ggcgagggcg aaagccgagg ctgaggccaa ggcgaaagcc       960
     gaggctgagg cgagggcgaa ggctgaggct gaggcgaggg cgaaggctga ggctgaggcg      1020
     aaggccaagg ctgaggccga ggcggccgcc gtggccaagg ctgaggctga cgccagggcc      1080
     aaggctgagg aggaggagag aaggagagcc gccgaggatg ccgctttatt ggccgacggc      1140
     tcgtgcgaaa tctgcggcgt tgacgacgac gacggcctcc tctgcgacgg gtgcgacggg      1200
     gtgtttcacg ccaagtgcgt ggatttggat tcgacacccg cgaacgagtg gttctgcgcg      1260
     cggtgcgccg agcacggggt gacgaatgcg ggcgggggcg tcgcgcagag gagagccgca      1320
     aagcggaaaa aggcaaacga cgagaagagg agggccaacc ctttcttcat gaccccggac      1380
     gagcggcgcg tggcggccga gagggaggcg aagcaggcgc tcatgcgcga cctcgaggct      1440
     gtgaaacaga cggacgcggc cctgtccacc gggaagaagg tgcaccactt cttcgccatg      1500
     caaaaggaaa aagcggcggc ggcgaaggag agcggcgcga gcgccgcgtc tctcaacccg      1560
     ctcgggctct acgtcctccc cgcgccgatc gagagggcca tgccgccggt tcatatcacc      1620
     ccacccatcg acccgaccgt cgcggaggac gaggcggtcg gcaggaacgc gctcgcgtcc      1680
     gtcgcgggcc cgccgcggaa aataactcga gatggacggt ttaacccgtc gcccgacgcg      1740
     acgctcgatt cgatcagacg cgcgctctcg ccccccgcgg cggtggacac cgaggaggag      1800
     caagaggagg aggacccggg cggtgaggaa ggcgtggacc tggaggaggc ggaggatgcc      1860
     tacctcaccg acgcggcgcg atacgtgttg gcgtccgagg gtcgatggaa cgccggcgcc      1920
     atcgtctccg gcgagctcgc gtcggcgcgc ggcgagctcc gagcgcgact cgcgtcgctc      1980
     agggctcgcg gcgccgctcg ggccgccggg cgcgacggtt catcttccac cgacggttcg      2040
     cgtttggatc ggtcgactcc ctcgatcggt cccgccgccg ccgccggtgc cctgtggacg      2100
     gacgcgtacg cgccggccgc cacggatcag ctggtgtgcg acggcggcgc ggctcgaggg      2160
     gttcgcgatt ggctcgacgc gtggtcgtcg cggattttcg ccgaggaggc gggggtggtt      2220
     gtgaaaccgc ccaaggacaa ggaaaaggcg ggaaacggcg ggaggaaggg gaagcggcgg      2280
     aagaagggac gcgggaacgc ggcagcaagc gacgacgata cgagcgacga ggagtgcgac      2340
     gagtgggacg acgagagcag cgggagcctc ggaacgtacg cgcccctggt gaccaagaga      2400
     ggcggccttc ccgcgaacgg tcttttgctg tgcgggcccg tcggttcggg taagacttcg      2460
     gccgtgtacg ccgcggcgga ggagtttggg ttcaaggtgc tcgaggttaa cccctcgcgc      2520
     aagcgcagcg ggctcgaggt gctcagccag tttggcgagg cgacgcagtc gagacgaatc      2580
     ggcggagggg gcgacgagca gaaaaaacag ggcgccggcg gcatcggggg cttcttcggc      2640
     aagaaacccg ccccggcggc gacgacgacg tccgcacccg cgaaggacac cgccaaaaag      2700
     gacaccgcca aggagacggc gcggaacacg ctgatactct tcgaggaggt ggacgtcctg      2760
     cggggcgagg atcggggttt catggcggcg ctcgcgcagc tcatcgccgg cgccaagcgc      2820
     cccatcgtcc tcacctccaa ctccccttcc ctcccctcct tgatcgacgc gccgctcccg      2880
     gcgggaacat ccggcgacgg cctgaggctc gcgcgggttc gtttcaggag cccgtcccca      2940
     gccgacgccg ccgtctacgc gtcgttggtg gcggccgcgg agggtaagcg ggtctcgccc      3000
     ggtgaggtgg cgtcggcggc gcggctcgcc gacgccggtg acgttcgcag agctttgctc      3060
     tccgcgcagt tcgccgcgtc gagcccagcc gcggagatga cgcgacgacc gacccgtggc      3120
     acgaccaagt cgcgatcgac ggcggcggtc gcggcgctcg agtacgacac caacgccgtc      3180
     gcggccgtcg cggccgagct gatcgcgcgg gtggacccgc gcgtcgccgc cgcggaggct      3240
     ctcgcgccgg cgagggcgct gtatgctatg agcctcgtag ccgaagcgag ccaaatcgag      3300
     gagcgcgaga cggagcgccg ggcggaggag gcggccgtgc gcaggcgcgc ggaggttgtc      3360
     gccgccgccg ccgccgccaa ggctgaacgc gccgccagga acgacgcgag gatcgagaag      3420
     gggccgttag gatcggttgg cgggcgaggg ggggatcgca ggggttcact cggactcgtc      3480
     gccgccgggc gttcggcggc gaacggcgac gacgaggacg gagaggaggc tgagcgggcg      3540
     gcgaaggtcg ccgcggctgc cgacgccgcg cgcgacgcct acctcgccga ggctgccgcc      3600
     aggttcgccg agcgagcgcc gggcggtgag tcaccgggcg gtgactcacc ggagacgccc      3660
     ccggacgcgt accccggcga cgactgggct cgcgccctcc gcgagctgga ctcgctcgcg      3720
     tcgctctccg cgtcgctctc cgcggcggac gccatgctta accccgcgcg cgccaccgtc      3780
     acgggcccgt ccaacggcgc cgccgagcgc gtcgacgtcg gcggctggct cggcggcgcc      3840
     ggggcagcgt ggggcgacgg cggcgacggc ggctggttcg acccgagcga cgacgcggag      3900
     gagaggggcg gtgcggacct ggcgggggaa ccgaggcaca cgatcggcgg gggcggggac      3960
     gtcgcgaggg aagcatccgc gcgcatcgag cgtctcgccg tggacgcgtg cctcggagat      4020
     cggctcgtcg actgtcgtcc tcctcctcgc gggggtgtcg gcgggggacc cccccccgcg      4080
     gcgactggcc cggcatcttc cgttccgaag ccggcggtct cttacgggcg ggtacccgcg      4140
     atgggcgccg cggccgcgag gctgcgcgag ctcgcggagt gcaccggggc gacgtgcgcg      4200
     aggggttacg ggtgcgggct cggcgcgacg ggcgaggcca acgagcgagc ttttttcttg      4260
     gcgaggatcg ttcggatcca ggaggagagc gcgagcgggg tcggggcgga gggcgggcgg      4320
     cggcgtcgta agaaggcgtc gcagtacctt caggtcggcg cggacgtggc gagggagttg      4380
     gccgcgctcg ggacgttcgg ggttaccgcg tga                                   4413
//

If you have problems or comments...

PBIL Back to PBIL home page