(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE64

MICSR_1.PE64         Location/Qualifiers
FT   CDS_pept        complement(123029..123388)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636069"
FT                   /orf_name="MICPUN_56636"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62061.1"
FT                   /db_xref="UniParc:UPI000199AC2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U1"
FT                   /transl_table=1
FT                   /translation="MSTTVTVIRKRPHCSATSVHEQEAIKLMPPPPPLLVPVMESEWER
FT                   KRRQSDIRRAENAFMEQQLRRERAEVERIACERTRIAMDNCERSELHAFLEELRVSGRV
FT                   SADEIVKRLACRVPA"
     atgagcacga ccgtcaccgt catccgaaag cggccgcact gcagcgccac cagcgtgcac        60
     gagcaggaag ccatcaagct aatgccccct cccccgcccc tcttggtgcc ggtgatggag       120
     tcggagtggg agagaaagag gcgccagtcc gatattcgcc gcgcagagaa cgcgtttatg       180
     gagcagcaat tgaggcggga gagggcggag gtggagagga tcgcgtgcga gcggacgcgc       240
     atcgccatgg acaactgcga gcgatcggag ctgcacgcat ttctggagga gcttcgcgtc       300
     tccggcaggg tctccgcgga cgagatcgtc aagcgactcg cctgccgcgt cccagcctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page